(data stored in ACNUC30630 zone)

EMBL: CP002344.PE346

CP002344.PE346       Location/Qualifiers
FT   CDS             409247..409942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:ZK265.2 COLlagen; SPTR: Protein ZK265.2,
FT                   confirmed by transcript evidence"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50471"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG54"
FT                   /protein_id="ADU50471.1"
FT                   /translation="MQAGWTSLIVTVAVLAAVVLLARSLVRARPRLRALRQQQEWQASR
FT                   EADREAARRVLAVPMAEWPLLERLPEGVPPHPAYYATRCTVLEERPEGGFASRGQGWLV
FT                   VGRDSLFFHPDPDGPRPGEPGADEPRRRGDRRGERAGAPGGTQGGPNPAGRAGASGEAS
FT                   PGGAAGPEPLAIPYSAIERVDSPYVNVLEVIAQDPVTRAWTSHFFRMNRPLVVAAYLSR
FT                   LARFELILS"
     MQAGWTSLIV TVAVLAAVVL LARSLVRARP RLRALRQQQE WQASREADRE AARRVLAVPM        60
     AEWPLLERLP EGVPPHPAYY ATRCTVLEER PEGGFASRGQ GWLVVGRDSL FFHPDPDGPR       120
     PGEPGADEPR RRGDRRGERA GAPGGTQGGP NPAGRAGASG EASPGGAAGP EPLAIPYSAI       180
     ERVDSPYVNV LEVIAQDPVT RAWTSHFFRM NRPLVVAAYL SRLARFELIL S                231
//

If you have problems or comments...

PBIL Back to PBIL home page