(data stored in ACNUC30630 zone)

EMBL: CP002344.PE347

CP002344.PE347       Location/Qualifiers
FT   CDS             complement(410055..411179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0349"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="COGs: COG2385 Sporulation protein and related
FT                   protein; InterPro IPR013486: IPR013693; KEGG: slp:Slip_0673
FT                   SpoIID/LytB domain protein; PFAM: Stage II sporulation
FT                   protein D; SPTR: SpoIID/LytB domain; TIGRFAM: SpoIID/LytB
FT                   domain protein; PFAM: Stage II sporulation protein;
FT                   TIGRFAM: SpoIID/LytB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50472"
FT                   /db_xref="GOA:E6SG55"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG55"
FT                   /protein_id="ADU50472.1"
FT                   /translation="MTDHHQARPGPGGRGAGGALPAGAAAIWAGVALVLIYAVLATGPL
FT                   AGLPAARPPGTGPGGTGPGEACPGGPGRAGGPEPAGEDGGAAPLDPALARRFAREPQIT
FT                   VFDHAAGAPRGMGMETYVAHVVAGETLPGWRPDALRAQAVAARTYTVSLLMAGEASTPR
FT                   RLYGTDTSTDPAEAQAFRPVVPPAVRAAVEATRGEILVYGGKPIVALFSACAAERTAGL
FT                   RESFPGDDRPAPYLRPVPSPCDRAAPDFIRRWSVALTSSELAGVAGVSPVEVRAVDIAR
FT                   RGPSGRAVLIRIGPRLVHAADLRRQIGPDRLKSTFVTEIEARQGGVWIFRGRGWGHGVG
FT                   LDQWGAEAMARDGRSYRDILAHYYPGTALVQLYR"
     MTDHHQARPG PGGRGAGGAL PAGAAAIWAG VALVLIYAVL ATGPLAGLPA ARPPGTGPGG        60
     TGPGEACPGG PGRAGGPEPA GEDGGAAPLD PALARRFARE PQITVFDHAA GAPRGMGMET       120
     YVAHVVAGET LPGWRPDALR AQAVAARTYT VSLLMAGEAS TPRRLYGTDT STDPAEAQAF       180
     RPVVPPAVRA AVEATRGEIL VYGGKPIVAL FSACAAERTA GLRESFPGDD RPAPYLRPVP       240
     SPCDRAAPDF IRRWSVALTS SELAGVAGVS PVEVRAVDIA RRGPSGRAVL IRIGPRLVHA       300
     ADLRRQIGPD RLKSTFVTEI EARQGGVWIF RGRGWGHGVG LDQWGAEAMA RDGRSYRDIL       360
     AHYYPGTALV QLYR                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page