(data stored in ACNUC30630 zone)

EMBL: CP002344.PE349

CP002344.PE349       Location/Qualifiers
FT   CDS             412539..413165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ath:AT5G07540 GRP16 (GLYCINE-RICH PROTEIN 16);
FT                   lipid binding / nutrient reservoir; SPTR: Oleosin; PFAM:
FT                   Small, acid-soluble spore proteins, alpha/beta type"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50474"
FT                   /db_xref="GOA:E6SG57"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG57"
FT                   /protein_id="ADU50474.1"
FT                   /translation="MRSQEPAQVPGGGTDPRVAAGSPGGLGEGAGDGPAGDADEPAAGL
FT                   AAGLTSDSATGGAPGAAPWGSGAPGDADEGDPAAAEPATGDLTAGAAPSPWAGVELPPT
FT                   ATSRRRRKRGHRGGVGRRGGRRVAQPNPEDDPLYPFKVQAAKELGLWPKVEAEGWGALT
FT                   SLESGRIGGYMQRLVKEAQEEGRIPPEVVQRLMQQRRIRPASTET"
     MRSQEPAQVP GGGTDPRVAA GSPGGLGEGA GDGPAGDADE PAAGLAAGLT SDSATGGAPG        60
     AAPWGSGAPG DADEGDPAAA EPATGDLTAG AAPSPWAGVE LPPTATSRRR RKRGHRGGVG       120
     RRGGRRVAQP NPEDDPLYPF KVQAAKELGL WPKVEAEGWG ALTSLESGRI GGYMQRLVKE       180
     AQEEGRIPPE VVQRLMQQRR IRPASTET                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page