(data stored in ACNUC30630 zone)

EMBL: CP002344.PE350

CP002344.PE350       Location/Qualifiers
FT   CDS             413226..413969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0352"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG1234 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III; KEGG: amt:Amet_3060
FT                   beta-lactamase domain-containing protein; SPTR:
FT                   Beta-lactamase domain protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50475"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG58"
FT                   /protein_id="ADU50475.1"
FT                   /translation="MRLTILGRDGPYPAPGGACSGYLLEGPQGPVLLDCGPGVLARLRQ
FT                   RVDVPQLAAVFYSHYHPDHCSDHFVLRYVLDIARYLGCQRPEPLPLYGPARPADLAGRM
FT                   PYKDVFTPHFLDPGESVAIAGFDVEVRATDHPIPCLASSWSAGGRRVVYSGDTGPGAAA
FT                   ELVQLARGADLLLIEASLLARRGDRAPGHLTARQAAEIAREAGVRQLLLTHLLPEYDPQ
FT                   EVLAEAQEVFPAARLAEPGATVELP"
     MRLTILGRDG PYPAPGGACS GYLLEGPQGP VLLDCGPGVL ARLRQRVDVP QLAAVFYSHY        60
     HPDHCSDHFV LRYVLDIARY LGCQRPEPLP LYGPARPADL AGRMPYKDVF TPHFLDPGES       120
     VAIAGFDVEV RATDHPIPCL ASSWSAGGRR VVYSGDTGPG AAAELVQLAR GADLLLIEAS       180
     LLARRGDRAP GHLTARQAAE IAREAGVRQL LLTHLLPEYD PQEVLAEAQE VFPAARLAEP       240
     GATVELP                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page