(data stored in ACNUC30630 zone)

EMBL: CP002344.PE354

CP002344.PE354       Location/Qualifiers
FT   CDS             complement(417648..418007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bts:Btus_1024 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50479"
FT                   /db_xref="GOA:E6SG62"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG62"
FT                   /protein_id="ADU50479.1"
FT                   /translation="MARLSVGHLIYVACIAAGIVVGGSLAGGLARLLFVQVPLDAPSSL
FT                   PVGSLPDLANRLKLWGTFAALGGTLSALQNLESGILGRSFGVAAAQLLLILSAFTGAHL
FT                   AYVALRYLAGAPPGS"
     MARLSVGHLI YVACIAAGIV VGGSLAGGLA RLLFVQVPLD APSSLPVGSL PDLANRLKLW        60
     GTFAALGGTL SALQNLESGI LGRSFGVAAA QLLLILSAFT GAHLAYVALR YLAGAPPGS        119
//

If you have problems or comments...

PBIL Back to PBIL home page