(data stored in ACNUC30630 zone)

EMBL: CP002344.PE357

CP002344.PE357       Location/Qualifiers
FT   CDS             complement(419823..420071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0359"
FT                   /product="SpoVT/AbrB domain-containing protein"
FT                   /note="InterPro IPR007159; KEGG: ate:Athe_1988
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain-containing protein; SPTR: Transcriptional regulator,
FT                   AbrB family; PFAM: SpoVT / AbrB like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50482"
FT                   /db_xref="GOA:E6SG65"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG65"
FT                   /protein_id="ADU50482.1"
FT                   /translation="MAVARVQGRGQFTLPAAFRKAVGVKPGDVLLLEARDPGHFEVRVL
FT                   SRQSLLDFPRIDAEGFNMRSARDAMERALAEEAFESP"
     MAVARVQGRG QFTLPAAFRK AVGVKPGDVL LLEARDPGHF EVRVLSRQSL LDFPRIDAEG        60
     FNMRSARDAM ERALAEEAFE SP                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page