(data stored in ACNUC30630 zone)

EMBL: CP002344.PE365

CP002344.PE365       Location/Qualifiers
FT   CDS             425376..425807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0367"
FT                   /product="protein of unknown function DUF1094"
FT                   /note="InterPro IPR009474; KEGG: aac:Aaci_2088 protein of
FT                   unknown function DUF1094; PFAM: protein of unknown function
FT                   DUF1094; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1094)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50490"
FT                   /db_xref="InterPro:IPR009474"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG73"
FT                   /protein_id="ADU50490.1"
FT                   /translation="MSMEMLDMFFAPMREELVRLGFTELRTPEEVDAAMAEAGDDDVTL
FT                   VVVNSMCGCAGGIARPAVAMALEHERRPQRWLTVFASQDREATARMREYFTGQPPSSPS
FT                   IALLKGRQLVYMLHRSDIENRTAEEVAADLKAAFDRFCA"
     MSMEMLDMFF APMREELVRL GFTELRTPEE VDAAMAEAGD DDVTLVVVNS MCGCAGGIAR        60
     PAVAMALEHE RRPQRWLTVF ASQDREATAR MREYFTGQPP SSPSIALLKG RQLVYMLHRS       120
     DIENRTAEEV AADLKAAFDR FCA                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page