(data stored in ACNUC30630 zone)

EMBL: CP002344.PE368

CP002344.PE368       Location/Qualifiers
FT   CDS             428050..431787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0370"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0587 DNA polymerase III alpha subunit;
FT                   InterPro IPR006162: IPR003141: IPR004805: IPR004013: IPR
FT                   011708: IPR004365; KEGG: hmo:HM1_0084 DNA polymerase III
FT                   alpha subunit, putative; PFAM: DNA polymerase III alpha
FT                   subunit; PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; PRIAM: DNA-directed DNA polymerase;
FT                   SMART: phosphoesterase PHP domain protein; SPTR: DNA
FT                   polymerase iii alpha subunit, putative; TIGRFAM: DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain; Bacterial
FT                   DNA polymerase III alpha subunit; OB-fold nucleic acid
FT                   binding domain; TIGRFAM: DNA-directed DNA polymerase III
FT                   (polc)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50493"
FT                   /db_xref="GOA:E6SG76"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG76"
FT                   /protein_id="ADU50493.1"
FT                   /translation="MQPFVHLHVHSEYSLLDGAARVGELAARAAELGMPALALTDHGVM
FT                   YGAIDFYKACKKHGIKPIIGCELYLARRTRHDREPKVDDQSYHLLALAQNETGYRNLIK
FT                   IVSRAYAEGFYYKPRADKELLAEHSEGLIVTSGCIGSEIPRLLLEGREEEALKAVRWYL
FT                   EVFGDRFYFEIQDHGIPEERRAYARILELARRFDVPVVATNDVHYLHKDDAAAHEVLLC
FT                   IQTGKTLDDPHRMRFDGAEFYLKSPEEMAALFRDVPEALANTVQLAERCQLEFEFGRFL
FT                   LPHYEVPEGHDAASYLRYLCETKLPERYPDAGSEVWDRLNHELAVITRMGYPAYFLIVW
FT                   DFVDYARRNGIAVGPGRGSAAGSLVAYVLGITDIDPLRYNLLFERFLNPERVTMPDIDI
FT                   DFDDHRRDEVIDYVVRKYGRDRVAQIITFGRMLARAVIRDVGRVMGLPYGEVDKIAKMV
FT                   PAQLGITLDQALEASPELKQAYEQQPVVRQLVDMARKLEGMPRHASVHAAGVVIGRDPL
FT                   MEHVPLQRMQDGSTVTQFPMTTLEELGLLKMDFLGLRTLHVIQETEAIINTTGARDVLA
FT                   GESGGGGAEEPGAAPRFRVRDIPLDDPATFEAMSRGDTAAMFQVESSGFTQMLRSLRPS
FT                   SIEDLIAAVALFRPGPLGSGMVDDFIKRKHGQVPVEYPHPWLEPILKETYGTIVYQEQV
FT                   MQIASVMAGFTLGEADLLRRAMGKKKPEEMQKQREKFLAGAEAKGVDRKLAEHIFDLME
FT                   YFAGYGFNKSHSAAYGYLAYVTAYLKTHYPAPYMAATLSSVMSNSDRVAEYIGECRRLG
FT                   IPVLPPDINESQALFTVVPDPRAPGGQAIRFGLAAVKNVGFGAIESIVSAREQGGPFRS
FT                   LDDFCRRVDLRQVNRRALESLIKAGAFDSLGHPRARLLAGLEEVMERAQRWQKERETGQ
FT                   VSLLDLTAALVGAGGGSGAPGAAGAAAGAGAPEGFGSRAGGGRRRGKGAAPGGGAGASG
FT                   RTGAGAADPGGAGGLGPAGAGNGHDPARAAASLWGDEATELPPVEEWPPNRKLAMEKEV
FT                   LGLYLSGHPLAHYQRELARRVTATTRQLAEREDGARVQVGGLVQGVRRITTRSGELMAF
FT                   VQLEDLEGSVEVVVFPRTYGEAAEALQEDAVIVVRGRVDRREEEEPPKVVAEEIWPLVT
FT                   GKRLVVALPGGGPDAVEGVLARVRGACQRHPGTSPVVLVFPGREHALQVDAQYWVTPRA
FT                   ELFQDLARVVGDNGFYLDDH"
     MQPFVHLHVH SEYSLLDGAA RVGELAARAA ELGMPALALT DHGVMYGAID FYKACKKHGI        60
     KPIIGCELYL ARRTRHDREP KVDDQSYHLL ALAQNETGYR NLIKIVSRAY AEGFYYKPRA       120
     DKELLAEHSE GLIVTSGCIG SEIPRLLLEG REEEALKAVR WYLEVFGDRF YFEIQDHGIP       180
     EERRAYARIL ELARRFDVPV VATNDVHYLH KDDAAAHEVL LCIQTGKTLD DPHRMRFDGA       240
     EFYLKSPEEM AALFRDVPEA LANTVQLAER CQLEFEFGRF LLPHYEVPEG HDAASYLRYL       300
     CETKLPERYP DAGSEVWDRL NHELAVITRM GYPAYFLIVW DFVDYARRNG IAVGPGRGSA       360
     AGSLVAYVLG ITDIDPLRYN LLFERFLNPE RVTMPDIDID FDDHRRDEVI DYVVRKYGRD       420
     RVAQIITFGR MLARAVIRDV GRVMGLPYGE VDKIAKMVPA QLGITLDQAL EASPELKQAY       480
     EQQPVVRQLV DMARKLEGMP RHASVHAAGV VIGRDPLMEH VPLQRMQDGS TVTQFPMTTL       540
     EELGLLKMDF LGLRTLHVIQ ETEAIINTTG ARDVLAGESG GGGAEEPGAA PRFRVRDIPL       600
     DDPATFEAMS RGDTAAMFQV ESSGFTQMLR SLRPSSIEDL IAAVALFRPG PLGSGMVDDF       660
     IKRKHGQVPV EYPHPWLEPI LKETYGTIVY QEQVMQIASV MAGFTLGEAD LLRRAMGKKK       720
     PEEMQKQREK FLAGAEAKGV DRKLAEHIFD LMEYFAGYGF NKSHSAAYGY LAYVTAYLKT       780
     HYPAPYMAAT LSSVMSNSDR VAEYIGECRR LGIPVLPPDI NESQALFTVV PDPRAPGGQA       840
     IRFGLAAVKN VGFGAIESIV SAREQGGPFR SLDDFCRRVD LRQVNRRALE SLIKAGAFDS       900
     LGHPRARLLA GLEEVMERAQ RWQKERETGQ VSLLDLTAAL VGAGGGSGAP GAAGAAAGAG       960
     APEGFGSRAG GGRRRGKGAA PGGGAGASGR TGAGAADPGG AGGLGPAGAG NGHDPARAAA      1020
     SLWGDEATEL PPVEEWPPNR KLAMEKEVLG LYLSGHPLAH YQRELARRVT ATTRQLAERE      1080
     DGARVQVGGL VQGVRRITTR SGELMAFVQL EDLEGSVEVV VFPRTYGEAA EALQEDAVIV      1140
     VRGRVDRREE EEPPKVVAEE IWPLVTGKRL VVALPGGGPD AVEGVLARVR GACQRHPGTS      1200
     PVVLVFPGRE HALQVDAQYW VTPRAELFQD LARVVGDNGF YLDDH                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page