(data stored in ACNUC30630 zone)

EMBL: CP002344.PE372

CP002344.PE372       Location/Qualifiers
FT   CDS             434879..435763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0374"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="COGs: COG0414 Panthothenate synthetase; InterPro
FT                   IPR003721: IPR004821; KEGG: rca:Rcas_0333
FT                   pantoate--beta-alanine ligase; PFAM: Pantoate-beta-alanine
FT                   ligase; SPTR: Pantothenate synthetase; TIGRFAM:
FT                   pantoate/beta-alanine ligase; cytidyltransferase-related
FT                   domain protein; PFAM: Pantoate-beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50497"
FT                   /db_xref="GOA:E6SG80"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG80"
FT                   /protein_id="ADU50497.1"
FT                   /translation="MELVQDIAALRERIARWRREDPDGRVGFVPTMGYLHEGHLSLIRR
FT                   ARAECRRVVVSVFVNPLQFGPQEDFARYPRDLERDLRLAAGAGADLLFHPPVEAMYPHG
FT                   DPGVFVDVGDLARRWEGARRPGHFRGVVTVVTKLFHLVQPDRAYFGQKDAQQAVIVRRM
FT                   VADLNFPLEVVVCPTVREPDGLAMSSRNVYLDEDQRRAAPILYRALQAARRRLEAGERS
FT                   GPALVEAMEAVLGGQPLIDPEYAAVVDAATLEPLERVEGEVLLLVAARLGSTRLIDNLW
FT                   LVVEGDRVRDRWT"
     MELVQDIAAL RERIARWRRE DPDGRVGFVP TMGYLHEGHL SLIRRARAEC RRVVVSVFVN        60
     PLQFGPQEDF ARYPRDLERD LRLAAGAGAD LLFHPPVEAM YPHGDPGVFV DVGDLARRWE       120
     GARRPGHFRG VVTVVTKLFH LVQPDRAYFG QKDAQQAVIV RRMVADLNFP LEVVVCPTVR       180
     EPDGLAMSSR NVYLDEDQRR AAPILYRALQ AARRRLEAGE RSGPALVEAM EAVLGGQPLI       240
     DPEYAAVVDA ATLEPLERVE GEVLLLVAAR LGSTRLIDNL WLVVEGDRVR DRWT             294
//

If you have problems or comments...

PBIL Back to PBIL home page