(data stored in ACNUC30630 zone)

EMBL: CP002344.PE373

CP002344.PE373       Location/Qualifiers
FT   CDS             436226..437398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0375"
FT                   /product="sporulation protein YhbH"
FT                   /note="COGs: COG2718 conserved hypothetical protein;
FT                   InterPro IPR014230: IPR006698; KEGG: sth:STH719
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF444; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   sporulation protein YhbH; PFAM: Protein of unknown function
FT                   (DUF444); TIGRFAM: sporulation protein YhbH"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50498"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG81"
FT                   /protein_id="ADU50498.1"
FT                   /translation="MPRGAIDWSLHRKGPVDQARHQEKVRAAIRENLADLIADDSLLTT
FT                   DGRRVVKVPVRSLREYRFRFSTRRNPQVGQGRGGSRKGDVLARQPGDPGGQGDPHAAGH
FT                   EPGMDYYETEVTLDELEAVLFEELELPNLQPRRQAVLDAQRPRFTEITRAGPLSRADLR
FT                   RALKENLKRHARQGQARLGPFHREDLRYRSWRDDPRPRTRAVVIAMRDVSGSMGESKKA
FT                   MSRTFFFWMNRFLESRYRDVQRVFITHHTEAQEVDEERFFHLGESGGTRVSSAYRLALE
FT                   IVAERYPPADWNLYAVHFSDGDNWGESDNGLCVQLVQELVEQASLFAYGEINESGYRSP
FT                   LWTAFERVRHPRFVRVKMTRREDIYPALRAIFRPNPADGAAGSETGGEGP"
     MPRGAIDWSL HRKGPVDQAR HQEKVRAAIR ENLADLIADD SLLTTDGRRV VKVPVRSLRE        60
     YRFRFSTRRN PQVGQGRGGS RKGDVLARQP GDPGGQGDPH AAGHEPGMDY YETEVTLDEL       120
     EAVLFEELEL PNLQPRRQAV LDAQRPRFTE ITRAGPLSRA DLRRALKENL KRHARQGQAR       180
     LGPFHREDLR YRSWRDDPRP RTRAVVIAMR DVSGSMGESK KAMSRTFFFW MNRFLESRYR       240
     DVQRVFITHH TEAQEVDEER FFHLGESGGT RVSSAYRLAL EIVAERYPPA DWNLYAVHFS       300
     DGDNWGESDN GLCVQLVQEL VEQASLFAYG EINESGYRSP LWTAFERVRH PRFVRVKMTR       360
     REDIYPALRA IFRPNPADGA AGSETGGEGP                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page