(data stored in ACNUC30630 zone)

EMBL: CP002344.PE376

CP002344.PE376       Location/Qualifiers
FT   CDS             complement(440717..441367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drt:Dret_1526 TspO and MBR like protein; SPTR:
FT                   Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50501"
FT                   /db_xref="GOA:E6SG84"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG84"
FT                   /protein_id="ADU50501.1"
FT                   /translation="MTAHGGLLAIPLHELTEAGLLAAGFALHSIGIPLTTVALFTLLTA
FT                   WAAQTDAGWLVAGGLAAAATLAGHALVLGLGRWWGWRGIAAAQQRWGSMQRVAERVDRL
FT                   ARSPSGWAVLTAWRWLGPGFAQAFWVLCTLPRWDRTLAALLAYLALHDVVWSFAWTYAL
FT                   VVLHLRAPAVAVWLDRLAWALLAGTLIWTLASRRRGRRPAAGSSRWGGAPAPR"
     MTAHGGLLAI PLHELTEAGL LAAGFALHSI GIPLTTVALF TLLTAWAAQT DAGWLVAGGL        60
     AAAATLAGHA LVLGLGRWWG WRGIAAAQQR WGSMQRVAER VDRLARSPSG WAVLTAWRWL       120
     GPGFAQAFWV LCTLPRWDRT LAALLAYLAL HDVVWSFAWT YALVVLHLRA PAVAVWLDRL       180
     AWALLAGTLI WTLASRRRGR RPAAGSSRWG GAPAPR                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page