(data stored in ACNUC30630 zone)

EMBL: CP002344.PE379

CP002344.PE379       Location/Qualifiers
FT   CDS             443048..444901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0381"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COGs: COG0469 Pyruvate kinase; InterPro IPR015793:
FT                   IPR001697: IPR015794: IPR008279; KEGG: adg:Adeg_0440
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PEP-utilising protein mobile region;
FT                   SPTR: Pyruvate kinase; TIGRFAM: pyruvate kinase; PFAM:
FT                   Pyruvate kinase, barrel domain; PEP-utilising enzyme,
FT                   mobile domain; Pyruvate kinase, alpha/beta domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50504"
FT                   /db_xref="GOA:E6SG87"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG87"
FT                   /protein_id="ADU50504.1"
FT                   /translation="MEFRRTKIVCTLGPSTDDPAVLRRLLQAGMDVARINLSHGTAADH
FT                   RRRVETLRAVAQEMGRHDVGILFDTRGPEVRVGALPGGALDLAAGQRVALVAAGHGEAG
FT                   AAPDGGPGGPAPAGSSASAGPVAAPGAAPAGCPVIPVSYSRVATSVGPGDRILLDDGNL
FT                   VLTVEDVDGVYVYCRVDAGGRLLQGKKATLPAESLDLPYLSEADRDDVRLGIELGIDFI
FT                   AASFVRSAADVHALRRVIEEAGGDQWVIAKIENRLGVERLDEILASADGIMVARGDLGV
FT                   ELPVEDIPLLQKQIIQAANRAGKPVITATQMLESMVRHPRPTRAESTDVANAIFDGTDA
FT                   VMLSAETAAGDYPVEAVEIMARIARRTETALDYGRRLARLAGQEHRTVTDAVSYASCTA
FT                   AESLGAAAILTATQSGYTSRMISRHRPRQPIVALTPSQRVARKLSLVWGVRALVIEPRD
FT                   SVDGLIDRALQGAVDGGFVRPGDLVVITAGVPVGQPGTTNMLQVHTVGEAVLRGTGVGQ
FT                   GSHTGPVRIVRDPEAAGPFHGGEVLVALSTDRDFVPLIEKAGALITEEGGLTSHAAIVG
FT                   LHRGIPTIVGAAGALETLKDGETVTVDARRGLVYRGWARVG"
     MEFRRTKIVC TLGPSTDDPA VLRRLLQAGM DVARINLSHG TAADHRRRVE TLRAVAQEMG        60
     RHDVGILFDT RGPEVRVGAL PGGALDLAAG QRVALVAAGH GEAGAAPDGG PGGPAPAGSS       120
     ASAGPVAAPG AAPAGCPVIP VSYSRVATSV GPGDRILLDD GNLVLTVEDV DGVYVYCRVD       180
     AGGRLLQGKK ATLPAESLDL PYLSEADRDD VRLGIELGID FIAASFVRSA ADVHALRRVI       240
     EEAGGDQWVI AKIENRLGVE RLDEILASAD GIMVARGDLG VELPVEDIPL LQKQIIQAAN       300
     RAGKPVITAT QMLESMVRHP RPTRAESTDV ANAIFDGTDA VMLSAETAAG DYPVEAVEIM       360
     ARIARRTETA LDYGRRLARL AGQEHRTVTD AVSYASCTAA ESLGAAAILT ATQSGYTSRM       420
     ISRHRPRQPI VALTPSQRVA RKLSLVWGVR ALVIEPRDSV DGLIDRALQG AVDGGFVRPG       480
     DLVVITAGVP VGQPGTTNML QVHTVGEAVL RGTGVGQGSH TGPVRIVRDP EAAGPFHGGE       540
     VLVALSTDRD FVPLIEKAGA LITEEGGLTS HAAIVGLHRG IPTIVGAAGA LETLKDGETV       600
     TVDARRGLVY RGWARVG                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page