(data stored in ACNUC30630 zone)

EMBL: CP002344.PE387

CP002344.PE387       Location/Qualifiers
FT   CDS             454736..455065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0389"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4877 conserved hypothetical protein; KEGG:
FT                   msv:Mesil_0344 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50512"
FT                   /db_xref="GOA:E6SG95"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG95"
FT                   /protein_id="ADU50512.1"
FT                   /translation="MQPGSGAAVRRPAGMTPASGREREVTLVPEKKRFLLRIDPVIYDA
FT                   IQRWAADEWRSVNGQIEYLLREALRRAGRLPAPVRGGRAQQDSGPPAGDSEGEGGSPPP
FT                   GTRGR"
     MQPGSGAAVR RPAGMTPASG REREVTLVPE KKRFLLRIDP VIYDAIQRWA ADEWRSVNGQ        60
     IEYLLREALR RAGRLPAPVR GGRAQQDSGP PAGDSEGEGG SPPPGTRGR                   109
//

If you have problems or comments...

PBIL Back to PBIL home page