(data stored in ACNUC30630 zone)

EMBL: CP002344.PE389

CP002344.PE389       Location/Qualifiers
FT   CDS             complement(456059..457219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0391"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR020613: IPR002155: IPR020616: IPR020617; KEGG:
FT                   rxy:Rxyl_2360 acetyl-CoA C-acyltransferase; PFAM:
FT                   Thiolase-like; PRIAM: Acetyl-CoA C-acyltransferase; SPTR:
FT                   Acetyl-CoA C-acyltransferase; TIGRFAM: acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase, C-terminal domain;
FT                   Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50514"
FT                   /db_xref="GOA:E6SG97"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG97"
FT                   /protein_id="ADU50514.1"
FT                   /translation="MGEPVLIGGVRTAFGRRDGVHRATRPDKLLSLALRGLVERTGLDP
FT                   AAVDDVITGCVTQTGEQGANVGRLGVLLAGFPVRVPAVSLNRMCGSSQQAIHFAAQAVA
FT                   AGDARYVIAAGVESMTRVPMFSDIRGGFETLNPELRERYELIHQGESAERIAERWGITR
FT                   QEADAFSAESHRRASAAARAGKNREIVPVEGLDAEGNPVTVTRDEGIRDRIDPARMAAL
FT                   PTVFRPEGRGIVTAGNSSQISDGASAVLVADREAALADGLRPKARFRARVVVGDDPTMQ
FT                   LTAVIPATRLALQRAGLTLRDIDWIEINEAFATVVLAWAREFDPDMERVNPWGGAIAHG
FT                   HPLGATGAGLMAKMLAGLEATGGQFGLQVMCIGHGMATATIIERLD"
     MGEPVLIGGV RTAFGRRDGV HRATRPDKLL SLALRGLVER TGLDPAAVDD VITGCVTQTG        60
     EQGANVGRLG VLLAGFPVRV PAVSLNRMCG SSQQAIHFAA QAVAAGDARY VIAAGVESMT       120
     RVPMFSDIRG GFETLNPELR ERYELIHQGE SAERIAERWG ITRQEADAFS AESHRRASAA       180
     ARAGKNREIV PVEGLDAEGN PVTVTRDEGI RDRIDPARMA ALPTVFRPEG RGIVTAGNSS       240
     QISDGASAVL VADREAALAD GLRPKARFRA RVVVGDDPTM QLTAVIPATR LALQRAGLTL       300
     RDIDWIEINE AFATVVLAWA REFDPDMERV NPWGGAIAHG HPLGATGAGL MAKMLAGLEA       360
     TGGQFGLQVM CIGHGMATAT IIERLD                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page