(data stored in ACNUC30630 zone)

EMBL: CP002344.PE39

CP002344.PE39        Location/Qualifiers
FT   CDS             34474..35748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0039"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="COGs: COG4653 phage phi-C31 gp36 major capsid-like
FT                   protein; InterPro IPR006444; KEGG: lga:LGAS_1485 phage
FT                   phi-C31 GP36 major capsid-like protein; SPTR: Phage major
FT                   capsid protein; TIGRFAM: phage major capsid protein, HK97
FT                   family; PFAM: Phage capsid family; TIGRFAM: phage major
FT                   capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50164"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH7"
FT                   /protein_id="ADU50164.1"
FT                   /translation="MDLKELVGKARQRVEEARRIVEEYAGKAMPADVKEQVDRLLAEAK
FT                   ELKAQADRAAEVQKLQAWLDEPQYRRPMNEGAAKALAPEDEPAEDGGLSEAQKKKQTRA
FT                   FFKALRGGLGVLTREERELLNPARKGLVATKALVEDAAGEILVPEEVEAEIYRRLPKLT
FT                   VIRPLATVRTTGSNRVRRRSLTELQVGWGKLETGTALVQSTPQPGEEYTYVEDLYGLTL
FT                   VGEDELDDTDVNLTSFVADSFAQAIAEAEDTAFIAGTGHANQQPEGILNAADVPTVAAG
FT                   QTAAITTDDILTLIYKVPAQHRRNGVLIANPETVLRLRLLKTTDGQYLWQPSLVAGQPD
FT                   TFAGYPVYDSVDVPTIPTTAGQTNKVAIFGDVRSGYRILDRQGMTVKVLQERYADQGLI
FT                   GYRVRYRVGGSVVRPEAFAILTVAA"
     MDLKELVGKA RQRVEEARRI VEEYAGKAMP ADVKEQVDRL LAEAKELKAQ ADRAAEVQKL        60
     QAWLDEPQYR RPMNEGAAKA LAPEDEPAED GGLSEAQKKK QTRAFFKALR GGLGVLTREE       120
     RELLNPARKG LVATKALVED AAGEILVPEE VEAEIYRRLP KLTVIRPLAT VRTTGSNRVR       180
     RRSLTELQVG WGKLETGTAL VQSTPQPGEE YTYVEDLYGL TLVGEDELDD TDVNLTSFVA       240
     DSFAQAIAEA EDTAFIAGTG HANQQPEGIL NAADVPTVAA GQTAAITTDD ILTLIYKVPA       300
     QHRRNGVLIA NPETVLRLRL LKTTDGQYLW QPSLVAGQPD TFAGYPVYDS VDVPTIPTTA       360
     GQTNKVAIFG DVRSGYRILD RQGMTVKVLQ ERYADQGLIG YRVRYRVGGS VVRPEAFAIL       420
     TVAA                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page