(data stored in ACNUC30630 zone)

EMBL: CP002344.PE394

CP002344.PE394       Location/Qualifiers
FT   CDS             466166..467491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0398"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterPro IPR013154: IPR013149; KEGG: tye:THEYE_A1024
FT                   sorbitol dehydrogenase; PFAM: Alcohol dehydrogenase GroES
FT                   domain protein; Alcohol dehydrogenase zinc-binding domain
FT                   protein; SPTR: Sorbitol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50519"
FT                   /db_xref="GOA:E6SGA2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA2"
FT                   /protein_id="ADU50519.1"
FT                   /translation="MAESAASRAPAGPVLPERMRAARLDARGRVEIAEMPVPRPGPGEA
FT                   LVRLRACGICSSDLLDWYVAGKARGGPFVFGHEPAGEIVAFGPGTQPPPGLEVGSRVFV
FT                   HHHAPCMACAACRRGDYVHCPVWRRPGLIPGGMAEYAVVAPQVLQHDTLPLPEGAGWEV
FT                   GVLVEPVACAVHALRRAGFEPGWRVAVIGAGFMGQALGLVARAWGAAERAVVDRLPGRL
FT                   AWAARRWATLVIDTGDEGRPGAVAGGAGGGPGMEPAATADGHAGERAAGNRGGGTPAGT
FT                   GRAGTGPGAVAAATGGGGGGRATPVPWLRPGPGADAQAVARMLEDRWGEGADLVLVTPA
FT                   GEEPLRLGIACARPGGTVVMFAPTAPGCDPAIPGYDVFFREIRLVPSYSAGPGDTRDAL
FT                   ALLAAGQVPAAELVTHRYPLADVATAYRQVKDPAALKVMVEL"
     MAESAASRAP AGPVLPERMR AARLDARGRV EIAEMPVPRP GPGEALVRLR ACGICSSDLL        60
     DWYVAGKARG GPFVFGHEPA GEIVAFGPGT QPPPGLEVGS RVFVHHHAPC MACAACRRGD       120
     YVHCPVWRRP GLIPGGMAEY AVVAPQVLQH DTLPLPEGAG WEVGVLVEPV ACAVHALRRA       180
     GFEPGWRVAV IGAGFMGQAL GLVARAWGAA ERAVVDRLPG RLAWAARRWA TLVIDTGDEG       240
     RPGAVAGGAG GGPGMEPAAT ADGHAGERAA GNRGGGTPAG TGRAGTGPGA VAAATGGGGG       300
     GRATPVPWLR PGPGADAQAV ARMLEDRWGE GADLVLVTPA GEEPLRLGIA CARPGGTVVM       360
     FAPTAPGCDP AIPGYDVFFR EIRLVPSYSA GPGDTRDALA LLAAGQVPAA ELVTHRYPLA       420
     DVATAYRQVK DPAALKVMVE L                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page