(data stored in ACNUC30630 zone)

EMBL: CP002344.PE395

CP002344.PE395       Location/Qualifiers
FT   CDS             467564..468169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0399"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="InterPro IPR013096; KEGG: aeh:Mlg_1167 cupin 2
FT                   domain-containing protein; PFAM: Cupin 2 conserved barrel
FT                   domain protein; SPTR: Cupin 2, conserved barrel domain
FT                   protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50520"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA3"
FT                   /protein_id="ADU50520.1"
FT                   /translation="MDERAAAAVPAVATPPAPEGGEPAGRSQGEAAPAGGLPAVNRPLT
FT                   AEEFARLRVRRFDPATFRWEGIPDQVYQGPADPALGFRDVIRRTLVPGGATPAAFEVRY
FT                   FEVAPGGYSRLELHQHVHAVLILRGEGEVQVGDQVYTVRPFDLVYVPPETPHQFRHRGG
FT                   EGDEPFGFLCVVDAQRDRPRPLEPRAGGHGSRPGASPR"
     MDERAAAAVP AVATPPAPEG GEPAGRSQGE AAPAGGLPAV NRPLTAEEFA RLRVRRFDPA        60
     TFRWEGIPDQ VYQGPADPAL GFRDVIRRTL VPGGATPAAF EVRYFEVAPG GYSRLELHQH       120
     VHAVLILRGE GEVQVGDQVY TVRPFDLVYV PPETPHQFRH RGGEGDEPFG FLCVVDAQRD       180
     RPRPLEPRAG GHGSRPGASP R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page