(data stored in ACNUC30630 zone)

EMBL: CP002344.PE398

CP002344.PE398       Location/Qualifiers
FT   CDS             470794..472209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0402"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="COGs: COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly; InterPro IPR003780; KEGG:
FT                   sti:Sthe_3102 cytochrome oxidase assembly; PFAM: cytochrome
FT                   oxidase assembly; SPTR: Cytochrome oxidase assembly; PFAM:
FT                   Cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50523"
FT                   /db_xref="GOA:E6SGA6"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA6"
FT                   /protein_id="ADU50523.1"
FT                   /translation="MARKNRASGETAVEDGGRPAGRRTPSTGAVRGDAARGRDSRPAPA
FT                   GRRAHRGLRALAATATITLFLVVVAGALVSATGSGEGCGRSWPLCGSPVWTVAAVIEFS
FT                   HRIVSGVAALAVVALAAVAPRRLGGRRDARWLAVVAIAFLFLQAGLGAGVVLWGQPDAV
FT                   LALHFGISLVSFASVALLSLRVWYATGTPVPVDADPAQRTGAGSRDADGNGTAAAPVAG
FT                   RAASPGLPGSGPTAPAFPAPWRRAIWFLLAYTYVVVYTGAYVRHTNTSLACPSWPACGG
FT                   PWEGPAAIQMVHRLAAGVLLVALVVMAVLARRGATGRDRSAPLRVPATGTGPGDPAGSL
FT                   PPGWVRGLSLAAGLAVLQALSGGYVVLSRLDLAATMLHSSLITLMFAVLCHLGLEALGP
FT                   RWSLASYGAPGLALGSPGPGLGGGGHGGRILPPEPAGRGSAPAPAGGTSPAGAGPFMAG
FT                   VGGSPGGRRGALS"
     MARKNRASGE TAVEDGGRPA GRRTPSTGAV RGDAARGRDS RPAPAGRRAH RGLRALAATA        60
     TITLFLVVVA GALVSATGSG EGCGRSWPLC GSPVWTVAAV IEFSHRIVSG VAALAVVALA       120
     AVAPRRLGGR RDARWLAVVA IAFLFLQAGL GAGVVLWGQP DAVLALHFGI SLVSFASVAL       180
     LSLRVWYATG TPVPVDADPA QRTGAGSRDA DGNGTAAAPV AGRAASPGLP GSGPTAPAFP       240
     APWRRAIWFL LAYTYVVVYT GAYVRHTNTS LACPSWPACG GPWEGPAAIQ MVHRLAAGVL       300
     LVALVVMAVL ARRGATGRDR SAPLRVPATG TGPGDPAGSL PPGWVRGLSL AAGLAVLQAL       360
     SGGYVVLSRL DLAATMLHSS LITLMFAVLC HLGLEALGPR WSLASYGAPG LALGSPGPGL       420
     GGGGHGGRIL PPEPAGRGSA PAPAGGTSPA GAGPFMAGVG GSPGGRRGAL S                471
//

If you have problems or comments...

PBIL Back to PBIL home page