(data stored in ACNUC30630 zone)

EMBL: CP002344.PE40

CP002344.PE40        Location/Qualifiers
FT   CDS             36032..36577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0040"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011738; KEGG: pla:Plav_0908 phiE125 gp8
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: phage conserved hypothetical protein,
FT                   phiE125 gp8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50165"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR036558"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH8"
FT                   /protein_id="ADU50165.1"
FT                   /translation="MPQLVTLAEAKSLLQSPAEDDGLVSDLIERASAAVESYTRRRILH
FT                   AKVLDLLPGGSKALVLRYRPVVSVEQVVDLESQQAVSTEDYVIDSRAGLILRRRGKWPK
FT                   GDLRWEVRYTAGYAATVDDVPADIKQAVLLLVQTWYQRRDPAIQQERIGDYSYTLADRR
FT                   GWPDAVQDLLAPYVEVVV"
     MPQLVTLAEA KSLLQSPAED DGLVSDLIER ASAAVESYTR RRILHAKVLD LLPGGSKALV        60
     LRYRPVVSVE QVVDLESQQA VSTEDYVIDS RAGLILRRRG KWPKGDLRWE VRYTAGYAAT       120
     VDDVPADIKQ AVLLLVQTWY QRRDPAIQQE RIGDYSYTLA DRRGWPDAVQ DLLAPYVEVV       180
     V                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page