(data stored in ACNUC30630 zone)

EMBL: CP002344.PE400

CP002344.PE400       Location/Qualifiers
FT   CDS             473881..474735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0404"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="COGs: COG1622 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 2; InterPro IPR002429: IPR001505:
FT                   IPR014222; KEGG: sus:Acid_5589 cytochrome c oxidase,
FT                   subunit II; PFAM: cytochrome c oxidase subunit II; SPTR:
FT                   Cytochrome c oxidase subunit 2; TIGRFAM: cytochrome c
FT                   oxidase, subunit II; PFAM: Cytochrome C oxidase subunit II,
FT                   periplasmic domain; TIGRFAM: cytochrome c oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50525"
FT                   /db_xref="GOA:E6SGA8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA8"
FT                   /protein_id="ADU50525.1"
FT                   /translation="MHQVTERENRRAGAVVTLLIGLVLVAGVASTVYATKRWWLPPLVS
FT                   ATAAPIDRMFNLLMVSIGIVFVLTQGALAWFVWKAARNPRALYWHENKRLESTWTVATA
FT                   VILTAFIVMGYQIWLSVHTPPAAAAEKTAVVEVWGQQFYWTARYPGPDGQFGKTDPQYV
FT                   DFKSNPFGIDPNDPAGQDDIVVDGSKGPIVMPAGYKVTVQLHSRDVIHSFFVPQLRVKL
FT                   DAVPGQVNELYVEPTEPGTYEIACAELCGVGHFAMRGEIQVLPESEWQSWLAEHAGEHG
FT                   AAQ"
     MHQVTERENR RAGAVVTLLI GLVLVAGVAS TVYATKRWWL PPLVSATAAP IDRMFNLLMV        60
     SIGIVFVLTQ GALAWFVWKA ARNPRALYWH ENKRLESTWT VATAVILTAF IVMGYQIWLS       120
     VHTPPAAAAE KTAVVEVWGQ QFYWTARYPG PDGQFGKTDP QYVDFKSNPF GIDPNDPAGQ       180
     DDIVVDGSKG PIVMPAGYKV TVQLHSRDVI HSFFVPQLRV KLDAVPGQVN ELYVEPTEPG       240
     TYEIACAELC GVGHFAMRGE IQVLPESEWQ SWLAEHAGEH GAAQ                        284
//

If you have problems or comments...

PBIL Back to PBIL home page