(data stored in ACNUC30630 zone)

EMBL: CP002344.PE402

CP002344.PE402       Location/Qualifiers
FT   CDS             476619..477329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0406"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: sus:Acid_5591
FT                   cytochrome c oxidase, subunit III; PFAM: cytochrome c
FT                   oxidase subunit III; SPTR: Cytochrome c oxidase, subunit
FT                   III; PFAM: Cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50527"
FT                   /db_xref="GOA:E6SGB0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGB0"
FT                   /protein_id="ADU50527.1"
FT                   /translation="MPTTTRKPPRTRHRLRRQGAAARPPVPVIAGRRVDTPGRIPPNGR
FT                   GGGGGWGGGPGDDEARARAATMATWMVVAAVTLMFMGFTSTYVARSAEPGWARQDLPPL
FT                   LWWNTAVLLASSVTMELARRRARKGLVAGARRALGVTTLLGLAFVAGQVAAWAQWLAAG
FT                   VVASGSTHAAFFYLLSGVHAAHVAGGLGALLYGMWRLGRPGTPAQMAASMTNIATYWHF
FT                   VDVLWLYLFALLLW"
     MPTTTRKPPR TRHRLRRQGA AARPPVPVIA GRRVDTPGRI PPNGRGGGGG WGGGPGDDEA        60
     RARAATMATW MVVAAVTLMF MGFTSTYVAR SAEPGWARQD LPPLLWWNTA VLLASSVTME       120
     LARRRARKGL VAGARRALGV TTLLGLAFVA GQVAAWAQWL AAGVVASGST HAAFFYLLSG       180
     VHAAHVAGGL GALLYGMWRL GRPGTPAQMA ASMTNIATYW HFVDVLWLYL FALLLW           236
//

If you have problems or comments...

PBIL Back to PBIL home page