(data stored in ACNUC30630 zone)

EMBL: CP002344.PE404

CP002344.PE404       Location/Qualifiers
FT   CDS             478119..478421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0408"
FT                   /product="cytochrome c oxidase subunit IV"
FT                   /note="KEGG: met:M446_3894 cytochrome c oxidase subunit IV;
FT                   SPTR: Cytochrome c oxidase subunit IV; TIGRFAM: caa(3)-type
FT                   oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50529"
FT                   /db_xref="GOA:E6SGB2"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGB2"
FT                   /protein_id="ADU50529.1"
FT                   /translation="MSGTAHSAVEHGHEHDHGNRLYFLTWLWLLLITVLEVGVVLVHMP
FT                   RAILVAVLLLMTVLKSGLIVANFMHLRFEKLNMIYIILTPMIFALIMWYGVALDY"
     MSGTAHSAVE HGHEHDHGNR LYFLTWLWLL LITVLEVGVV LVHMPRAILV AVLLLMTVLK        60
     SGLIVANFMH LRFEKLNMIY IILTPMIFAL IMWYGVALDY                             100
//

If you have problems or comments...

PBIL Back to PBIL home page