(data stored in ACNUC30630 zone)

EMBL: CP002344.PE41

CP002344.PE41        Location/Qualifiers
FT   CDS             36578..36811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_26870 hypothetical protein;
FT                   SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50166"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH9"
FT                   /protein_id="ADU50166.1"
FT                   /translation="MGESRNVIHLQVKVRPAVYAGLVQAVLAAAVRAGLLSPAKALDWF
FT                   WRIYRRTARVCVEPVQVNTTLKVVLDGAAPAE"
     MGESRNVIHL QVKVRPAVYA GLVQAVLAAA VRAGLLSPAK ALDWFWRIYR RTARVCVEPV        60
     QVNTTLKVVL DGAAPAE                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page