(data stored in ACNUC30630 zone)

EMBL: CP002344.PE417

CP002344.PE417       Location/Qualifiers
FT   CDS             493427..494812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_0515 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50542"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ6"
FT                   /protein_id="ADU50542.1"
FT                   /translation="MLEAVRIRPCSATGLLVGPDAQATIGIRGRRHVTLCHGNCREVVG
FT                   AWRDPAVPPGEIWLPRGVVDRLLAVPGIPYDVRWDGRELRLGPVVAVIVPQRSLAPSPD
FT                   RWADWAAAYDRVRGLLFVTDRAHLDLERGRASGYYLRPDPRGGQWQWGRFPLPEAAYRR
FT                   AALPAALYEQLPQRGTRLFDTECADKWTVYRWLSARPAVAPYLPWTVPVERLEDLPALV
FT                   RCRGRLMLKRREGCRGRGLLAVWGDGSAGFWVQRRDEPAPRHVPGDRELIACLRREFGP
FT                   HRYLAQQAVDLPERAGRRMDLRVIMQRDARGAWRCTGGAARFGKPGHIASNFVWEGGFG
FT                   CAPDRGLRLALGLDARAARRLWDGVREAALRVCQALDAYGEFGDLGLDMAVDRAGCIWL
FT                   LEVNCGLQVHRLAAFDGGAEAVRRVRQTPLLYARHLAGWPAVEPRAPSFLRSRAAGAGA
FT                   VRP"
     MLEAVRIRPC SATGLLVGPD AQATIGIRGR RHVTLCHGNC REVVGAWRDP AVPPGEIWLP        60
     RGVVDRLLAV PGIPYDVRWD GRELRLGPVV AVIVPQRSLA PSPDRWADWA AAYDRVRGLL       120
     FVTDRAHLDL ERGRASGYYL RPDPRGGQWQ WGRFPLPEAA YRRAALPAAL YEQLPQRGTR       180
     LFDTECADKW TVYRWLSARP AVAPYLPWTV PVERLEDLPA LVRCRGRLML KRREGCRGRG       240
     LLAVWGDGSA GFWVQRRDEP APRHVPGDRE LIACLRREFG PHRYLAQQAV DLPERAGRRM       300
     DLRVIMQRDA RGAWRCTGGA ARFGKPGHIA SNFVWEGGFG CAPDRGLRLA LGLDARAARR       360
     LWDGVREAAL RVCQALDAYG EFGDLGLDMA VDRAGCIWLL EVNCGLQVHR LAAFDGGAEA       420
     VRRVRQTPLL YARHLAGWPA VEPRAPSFLR SRAAGAGAVR P                           461
//

If you have problems or comments...

PBIL Back to PBIL home page