(data stored in ACNUC30630 zone)

EMBL: CP002344.PE421

CP002344.PE421       Location/Qualifiers
FT   CDS             complement(500161..501036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0425"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="COGs: COG3773 Cell wall hydrolyses involved in spore
FT                   germination; InterPro IPR002482: IPR018392: IPR011105;
FT                   KEGG: mta:Moth_0054 cell wall hydrolase, SleB; PFAM: cell
FT                   wall hydrolase SleB; Peptidoglycan-binding lysin domain;
FT                   SMART: Peptidoglycan-binding LysM; SPTR: Cell wall
FT                   hydrolase, SleB; PFAM: Cell Wall Hydrolase; LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50546"
FT                   /db_xref="GOA:E6SGK0"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK0"
FT                   /protein_id="ADU50546.1"
FT                   /translation="MAKRRWQRMLAGLTVGLAMAALAVMGSTARAAAAQGGPAFVTHYV
FT                   QRGETVWQIARRYGVPMADIVALNRLPSASVVWAGTYLAIPSVDRYDIYTVRYGDTLYT
FT                   IARAYGLTAAALKEANALATDLLLPGQRLIVPLGGGTAGSAAGSSAPAPAPSPAPASSR
FT                   GVTGGAGVQVSDYELRLLAQMVQAEAGGEPYVGKVAVAAVILNRVKSPLFPDTVAGVLF
FT                   EPYQFEPVLNGTFWQEPSAEAWQAAIDAVNGWDPTGGALYFWNPAKSGYQPFLETRPSA
FT                   GWIGNHRFAY"
     MAKRRWQRML AGLTVGLAMA ALAVMGSTAR AAAAQGGPAF VTHYVQRGET VWQIARRYGV        60
     PMADIVALNR LPSASVVWAG TYLAIPSVDR YDIYTVRYGD TLYTIARAYG LTAAALKEAN       120
     ALATDLLLPG QRLIVPLGGG TAGSAAGSSA PAPAPSPAPA SSRGVTGGAG VQVSDYELRL       180
     LAQMVQAEAG GEPYVGKVAV AAVILNRVKS PLFPDTVAGV LFEPYQFEPV LNGTFWQEPS       240
     AEAWQAAIDA VNGWDPTGGA LYFWNPAKSG YQPFLETRPS AGWIGNHRFA Y                291
//

If you have problems or comments...

PBIL Back to PBIL home page