(data stored in ACNUC30630 zone)

EMBL: CP002344.PE422

CP002344.PE422       Location/Qualifiers
FT   CDS             complement(501301..501927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0426"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="COGs: COG3773 Cell wall hydrolyses involved in spore
FT                   germination; InterPro IPR011105; KEGG: chy:CHY_1756
FT                   putative spore cortex-lytic enzyme; PFAM: cell wall
FT                   hydrolase SleB; SPTR: Putative spore cortex-lytic enzyme;
FT                   PFAM: Cell Wall Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50547"
FT                   /db_xref="GOA:E6SGK1"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK1"
FT                   /protein_id="ADU50547.1"
FT                   /translation="MRATAMEQAARPARMPAGRAGRGRWHGLPLVAAGLVLAFVLSGPA
FT                   AALAGASGPEAAGPKAAGDGAAQARTQATAVTPRALRAVHPPMRLSPREMRLLAQMIEA
FT                   EAAAEPYAGKVAVGAVILNRVRSPLFPDTVEEVIFEPWQFEPILNGWFWQEPGAASWRA
FT                   ARDAARGVDPTGGALYFWNPAKSGYQPHLESRPSAGWIGNHRFAY"
     MRATAMEQAA RPARMPAGRA GRGRWHGLPL VAAGLVLAFV LSGPAAALAG ASGPEAAGPK        60
     AAGDGAAQAR TQATAVTPRA LRAVHPPMRL SPREMRLLAQ MIEAEAAAEP YAGKVAVGAV       120
     ILNRVRSPLF PDTVEEVIFE PWQFEPILNG WFWQEPGAAS WRAARDAARG VDPTGGALYF       180
     WNPAKSGYQP HLESRPSAGW IGNHRFAY                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page