(data stored in ACNUC30630 zone)

EMBL: CP002344.PE43

CP002344.PE43        Location/Qualifiers
FT   CDS             37105..37596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ngk:NGK_1434 putative phage associated
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacteriophage protein of unknown function (DUF646)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50168"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI1"
FT                   /protein_id="ADU50168.1"
FT                   /translation="MAKVVTKWYLGEFMRAAQAHVVRGMTKAVLYCEGVAKQKVSRGNV
FT                   DGKNPSKPGEPPKTVTGTLRANIGHDVAVTPSEVIGMIGVRKGPANKYARRLELGFHGT
FT                   VKVKAHTRTQTHAWGRPLKTPKKVRVRAYSYTVNQAPRPYLRPTVAENKEQILKLIAKG
FT                   "
     MAKVVTKWYL GEFMRAAQAH VVRGMTKAVL YCEGVAKQKV SRGNVDGKNP SKPGEPPKTV        60
     TGTLRANIGH DVAVTPSEVI GMIGVRKGPA NKYARRLELG FHGTVKVKAH TRTQTHAWGR       120
     PLKTPKKVRV RAYSYTVNQA PRPYLRPTVA ENKEQILKLI AKG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page