(data stored in ACNUC30630 zone)

EMBL: CP002344.PE432

CP002344.PE432       Location/Qualifiers
FT   CDS             511596..511991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmo:HM1_2664 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50557"
FT                   /db_xref="GOA:E6SGL1"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL1"
FT                   /protein_id="ADU50557.1"
FT                   /translation="MEPPKRFPHPEQDEPGGPGEPFGPGRLPADGFDPEEEFDSPEEVD
FT                   AVFRSQRRLVMARVVWLILLVLGVPIANAWWPLWWNGWAGVPVTPAWAVAAGGGLVALW
FT                   LLGVQHARMADRVERAMLGRRREDDDV"
     MEPPKRFPHP EQDEPGGPGE PFGPGRLPAD GFDPEEEFDS PEEVDAVFRS QRRLVMARVV        60
     WLILLVLGVP IANAWWPLWW NGWAGVPVTP AWAVAAGGGL VALWLLGVQH ARMADRVERA       120
     MLGRRREDDD V                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page