(data stored in ACNUC30630 zone)

EMBL: CP002344.PE439

CP002344.PE439       Location/Qualifiers
FT   CDS             521059..524250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0443"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="InterPro IPR011260: IPR007630; KEGG: ttr:Tter_0596
FT                   sigma-70 region 4 domain protein; PFAM: sigma-70 region 4
FT                   domain protein; RNA polymerase alpha subunit domain
FT                   protein; SPTR: RNA polymerase sigma factor; PFAM: Bacterial
FT                   RNA polymerase, alpha chain C terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50564"
FT                   /db_xref="GOA:E6SGL8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL8"
FT                   /protein_id="ADU50564.1"
FT                   /translation="MELAPNAPAPVPPEASDAGAPGEHPGTAPGGAEGILGPAPRGGRA
FT                   AAGSSGTDAGGSVPGEESRSGRPRSGTSLAAIPLSLLAIPPRVRLALQQRGYDTVGDLA
FT                   RQPDTRLLATRGMGTRGLLSLVTELARVMADPAYQEDLLARAGRYDPGRFPDAVRNLAI
FT                   DDLGLSQRAYRALRRAGVQTVGQLLELGEAGLRRLRGLGPRSLDEICHRLDALQSGRPL
FT                   PPPGVGAGDPLAPELMDDPAPIAVLLLPRRVATALQRAGLHTVGAVAGFSQGGLRRLRG
FT                   LGESGVAAILDGFRRYRQERSQRDAAPRDLEDWLRELVEPLADREREVLALRYGLLGAE
FT                   PHDLAAIAARWQTTRQWVSVVQGRALRRARARARLDRFAPLVAAVQAAATRCGAAGPAE
FT                   LAEALRQEGTVAVPESADQAVRLVGLLVQVTPGLRRVAGSTWATLEVAQRLPEAARRLE
FT                   AYLAETGRPASLAELAGYLAEHMPDAPASPEAMARAVLATQGAFGRFPGGLYGLASWRV
FT                   GRRVRARDYVYQALERHGRPLHYAELTRLVNQLLPEGRKMPPTHVLTILSSGEPFRRFD
FT                   RGIYGLTHWEREPERNLAGLCRDALAERGEPATLNQVVEAVQQQRRYPRRTVARALNED
FT                   PAVLRYGRDRFGLSAWLAADPQAAGAVRAPAYGPRPTNLVAVRGLLTELLAGHVYDTAQ
FT                   LTAYLGRWRQRSQARQIIAYLHAVGWLTGIDDAWAATPLNEAWVRAGSEPAQLAALALA
FT                   DPAFAHALVLHEAFRRLDAADGPDGTGAGEGPDAAGAGDGPSARTAAGAVPGAFTPAQA
FT                   ARWLAQRIRRAADARGVEPGPGFRSLLRRQWLVTAWFDPWVALLADGRHSPGPGGEGAA
FT                   AAPDGDEPAAVAGTARSRTGTSRAVLWDHAARRLWPARPVHLPAAWLQTPATAWALLAD
FT                   AVAARQGGAAVDLEALAEWCREQGVAANPAQVEAELFALGLWPVQEGPRLRLYMPYRLV
FT                   VPPEGLRLPGLPAEGALLDAAAEVLRQAGVLTGLPAGWPAPPAAEVYGVPPLGAGGPAE
FT                   AAAHGEAGGLRAGDR"
     MELAPNAPAP VPPEASDAGA PGEHPGTAPG GAEGILGPAP RGGRAAAGSS GTDAGGSVPG        60
     EESRSGRPRS GTSLAAIPLS LLAIPPRVRL ALQQRGYDTV GDLARQPDTR LLATRGMGTR       120
     GLLSLVTELA RVMADPAYQE DLLARAGRYD PGRFPDAVRN LAIDDLGLSQ RAYRALRRAG       180
     VQTVGQLLEL GEAGLRRLRG LGPRSLDEIC HRLDALQSGR PLPPPGVGAG DPLAPELMDD       240
     PAPIAVLLLP RRVATALQRA GLHTVGAVAG FSQGGLRRLR GLGESGVAAI LDGFRRYRQE       300
     RSQRDAAPRD LEDWLRELVE PLADREREVL ALRYGLLGAE PHDLAAIAAR WQTTRQWVSV       360
     VQGRALRRAR ARARLDRFAP LVAAVQAAAT RCGAAGPAEL AEALRQEGTV AVPESADQAV       420
     RLVGLLVQVT PGLRRVAGST WATLEVAQRL PEAARRLEAY LAETGRPASL AELAGYLAEH       480
     MPDAPASPEA MARAVLATQG AFGRFPGGLY GLASWRVGRR VRARDYVYQA LERHGRPLHY       540
     AELTRLVNQL LPEGRKMPPT HVLTILSSGE PFRRFDRGIY GLTHWEREPE RNLAGLCRDA       600
     LAERGEPATL NQVVEAVQQQ RRYPRRTVAR ALNEDPAVLR YGRDRFGLSA WLAADPQAAG       660
     AVRAPAYGPR PTNLVAVRGL LTELLAGHVY DTAQLTAYLG RWRQRSQARQ IIAYLHAVGW       720
     LTGIDDAWAA TPLNEAWVRA GSEPAQLAAL ALADPAFAHA LVLHEAFRRL DAADGPDGTG       780
     AGEGPDAAGA GDGPSARTAA GAVPGAFTPA QAARWLAQRI RRAADARGVE PGPGFRSLLR       840
     RQWLVTAWFD PWVALLADGR HSPGPGGEGA AAAPDGDEPA AVAGTARSRT GTSRAVLWDH       900
     AARRLWPARP VHLPAAWLQT PATAWALLAD AVAARQGGAA VDLEALAEWC REQGVAANPA       960
     QVEAELFALG LWPVQEGPRL RLYMPYRLVV PPEGLRLPGL PAEGALLDAA AEVLRQAGVL      1020
     TGLPAGWPAP PAAEVYGVPP LGAGGPAEAA AHGEAGGLRA GDR                        1063
//

If you have problems or comments...

PBIL Back to PBIL home page