(data stored in ACNUC30630 zone)

EMBL: CP002344.PE440

CP002344.PE440       Location/Qualifiers
FT   CDS             524363..525553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0444"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /note="COGs: COG0166 Glucose-6-phosphate isomerase;
FT                   InterPro IPR011857: IPR001347: IPR019490; KEGG:
FT                   rmr:Rmar_1238 bifunctional phosphoglucose/phosphomannose
FT                   isomerase; PFAM: Bifunctional
FT                   glucose-6-phosphate/mannose-6-phosphate isomerase-like;
FT                   sugar isomerase (SIS); SPTR: Bifunctional
FT                   phosphoglucose/phosphomannose isomerase; TIGRFAM:
FT                   bifunctional phosphoglucose/phosphomannose isomerase; PFAM:
FT                   Bacterial phospho-glucose isomerase C-terminal region; SIS
FT                   domain; TIGRFAM: bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50565"
FT                   /db_xref="GOA:E6SGL9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL9"
FT                   /protein_id="ADU50565.1"
FT                   /translation="MDGTNPRTGAGPVVRGGPEPVAGAAGGPVDWQALRRYDVAGMLGA
FT                   VAAFPHQLEEAYRLGREAANLPRPLAERPRAVIVAGLGGSAIGGDFVAAVLEPEAPVPV
FT                   MVHRDYGLPGWVGPQDLVFAVSYSGATEETLSAYAAARRRGAAVVAVASGGPLLEQAAA
FT                   DEAAGAPVRRVAVPGGLAPRAALGYLMLPVLYLTCAWTGVGDPSAQVEEAVAVLRRQAR
FT                   ELEPNGPEGPAQTLAQRMLDRPLFLYGAGRLGQAAAYRWQCQLNENAKLLAHAHAFPEL
FT                   DHNEVMGWEGAPQPRDGDQRRPLSILLQAPADHPRNRARMEITAELVGDRAEWVTVTAQ
FT                   GQGRLAQLLSLSYLGDFVSVYAALLRGLDPSSIASIQRLKERLAALPAGDGTGPDR"
     MDGTNPRTGA GPVVRGGPEP VAGAAGGPVD WQALRRYDVA GMLGAVAAFP HQLEEAYRLG        60
     REAANLPRPL AERPRAVIVA GLGGSAIGGD FVAAVLEPEA PVPVMVHRDY GLPGWVGPQD       120
     LVFAVSYSGA TEETLSAYAA ARRRGAAVVA VASGGPLLEQ AAADEAAGAP VRRVAVPGGL       180
     APRAALGYLM LPVLYLTCAW TGVGDPSAQV EEAVAVLRRQ ARELEPNGPE GPAQTLAQRM       240
     LDRPLFLYGA GRLGQAAAYR WQCQLNENAK LLAHAHAFPE LDHNEVMGWE GAPQPRDGDQ       300
     RRPLSILLQA PADHPRNRAR MEITAELVGD RAEWVTVTAQ GQGRLAQLLS LSYLGDFVSV       360
     YAALLRGLDP SSIASIQRLK ERLAALPAGD GTGPDR                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page