(data stored in ACNUC30630 zone)

EMBL: CP002344.PE443

CP002344.PE443       Location/Qualifiers
FT   CDS             527802..528191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0447"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="InterPro IPR003646: IPR013247; KEGG: sth:STH1029
FT                   putative N-acetylmuramoyl-L-alanine amidase; PFAM: SH3 type
FT                   3 domain protein; SMART: SH3 domain protein; SPTR:
FT                   N-acetylmuramoyl-L-alanine amidase; PFAM: Bacterial SH3
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50568"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM2"
FT                   /protein_id="ADU50568.1"
FT                   /translation="MSRIRDLAAALREQERPLLDQYRQLVEAATTETERRLAQMMYNYQ
FT                   RFQLQSLELFQDRVPERFQCFGVITHDDVNVRQRPSGKSQTLTRVGRGTPVIVMAFDGF
FT                   WAEVQLVGGATGYVFKDYVRCEVGG"
     MSRIRDLAAA LREQERPLLD QYRQLVEAAT TETERRLAQM MYNYQRFQLQ SLELFQDRVP        60
     ERFQCFGVIT HDDVNVRQRP SGKSQTLTRV GRGTPVIVMA FDGFWAEVQL VGGATGYVFK       120
     DYVRCEVGG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page