(data stored in ACNUC30630 zone)

EMBL: CP002344.PE45

CP002344.PE45        Location/Qualifiers
FT   CDS             38037..38459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_2181 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Phage major tail
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50170"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI3"
FT                   /protein_id="ADU50170.1"
FT                   /translation="MPEGLNGSAVLVLVQTGTDATSGQPIFEAVAKQTGLSDESSRELI
FT                   DDSAKGDDHVSHLYGRAETSVELEAAYVPNDAAFQALWQAYLSKQDVVLRRTENGTMVE
FT                   EARAKIESISREFPDNDRSTVTVSFQLQEFWRKVTA"
     MPEGLNGSAV LVLVQTGTDA TSGQPIFEAV AKQTGLSDES SRELIDDSAK GDDHVSHLYG        60
     RAETSVELEA AYVPNDAAFQ ALWQAYLSKQ DVVLRRTENG TMVEEARAKI ESISREFPDN       120
     DRSTVTVSFQ LQEFWRKVTA                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page