(data stored in ACNUC30630 zone)

EMBL: CP002344.PE451

CP002344.PE451       Location/Qualifiers
FT   CDS             complement(536624..536914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:536876..536878,aa:Sec)
FT                   /locus_tag="Tmar_0455"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109; KEGG: bcg:BCG9842_B1149
FT                   glutaredoxin family protein; PFAM: glutaredoxin; SPTR:
FT                   Glutaredoxin family protein; manually curated; PFAM:
FT                   Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50576"
FT                   /db_xref="GOA:E6SGN0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN0"
FT                   /protein_id="ADU50576.1"
FT                   /translation="MPRKVELYMQPGUADCRHAEEFLRQLGVEFTAYDVRQDPAAYDRL
FT                   VNQYQSRVTATVVIDGKVFRGFGRHREAIERALKGEGDGEAAGAGNGDGDR"
     MPRKVELYMQ PGXADCRHAE EFLRQLGVEF TAYDVRQDPA AYDRLVNQYQ SRVTATVVID        60
     GKVFRGFGRH REAIERALKG EGDGEAAGAG NGDGDR                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page