(data stored in ACNUC30630 zone)

EMBL: CP002344.PE454

CP002344.PE454       Location/Qualifiers
FT   CDS             539669..541612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0458"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterPro IPR003439:
FT                   IPR017940: IPR017871: IPR003593: IPR 001140; KEGG:
FT                   tai:Taci_1285 ABC transporter related protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter; ABC transporter transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50579"
FT                   /db_xref="GOA:E6SGN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN3"
FT                   /protein_id="ADU50579.1"
FT                   /translation="MPGAWAAYRHLLRPYRGQTALAVVLLLARSGLDLGIPQILRWLLD
FT                   VAIPARDLGLLASGALVSLALVAGRAAVHYAAVYVSFDLTQRVVHDLRVRLFRHIASLP
FT                   LAFFHRERQGAVVSRLTTDVGAIERFVQAVFARLAGEFGGVLAVVATVIALQPALGMGL
FT                   ALLLPAAGAWFYLQTVRIRRLSREIQAQAGRLGARATEVVGAIATVKAYGGEPHEAARF
FT                   AAASQRYRSLNMERRRFIGRMESGADLMGNLGLLALFFIGGYLAIRGVLSPGRLAALVL
FT                   YLRMMLAPVRSLVNFHLILQEGLAAMERVQEILALPAEGARAEGAFPAEERQGALGSAE
FT                   PGHARPAATAGARQPSGSPGVAVLAPAWGAGVCPGPGVTAGAGAAAGAALEFAGIWFRY
FT                   QPGGPPVLKGVDLRVAPGERVALVGRSGAGKTTLLQLVPRFYDPERGAVYLDGRDVRDY
FT                   DLDGLRRQVAWVMQDPVLFAGTVAENIAYGCPDATPEAIRRAAELANAAAFIEALPQGY
FT                   DTPVGERGVRLSGGQRQRIAIARALLRRPRLLLLDEATSFQDAESEERIHEALDLLAAG
FT                   GCTCVVVAHRLSTALRADRIVVMDAGRVVETGTHAQLLAHGGLYARLYRTFFAPRRVAA
FT                   GGPGSGVPPAGP"
     MPGAWAAYRH LLRPYRGQTA LAVVLLLARS GLDLGIPQIL RWLLDVAIPA RDLGLLASGA        60
     LVSLALVAGR AAVHYAAVYV SFDLTQRVVH DLRVRLFRHI ASLPLAFFHR ERQGAVVSRL       120
     TTDVGAIERF VQAVFARLAG EFGGVLAVVA TVIALQPALG MGLALLLPAA GAWFYLQTVR       180
     IRRLSREIQA QAGRLGARAT EVVGAIATVK AYGGEPHEAA RFAAASQRYR SLNMERRRFI       240
     GRMESGADLM GNLGLLALFF IGGYLAIRGV LSPGRLAALV LYLRMMLAPV RSLVNFHLIL       300
     QEGLAAMERV QEILALPAEG ARAEGAFPAE ERQGALGSAE PGHARPAATA GARQPSGSPG       360
     VAVLAPAWGA GVCPGPGVTA GAGAAAGAAL EFAGIWFRYQ PGGPPVLKGV DLRVAPGERV       420
     ALVGRSGAGK TTLLQLVPRF YDPERGAVYL DGRDVRDYDL DGLRRQVAWV MQDPVLFAGT       480
     VAENIAYGCP DATPEAIRRA AELANAAAFI EALPQGYDTP VGERGVRLSG GQRQRIAIAR       540
     ALLRRPRLLL LDEATSFQDA ESEERIHEAL DLLAAGGCTC VVVAHRLSTA LRADRIVVMD       600
     AGRVVETGTH AQLLAHGGLY ARLYRTFFAP RRVAAGGPGS GVPPAGP                     647
//

If you have problems or comments...

PBIL Back to PBIL home page