(data stored in ACNUC30630 zone)

EMBL: CP002344.PE460

CP002344.PE460       Location/Qualifiers
FT   CDS             546423..547415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0464"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="COGs: COG1494 Fructose-1
FT                   6-bisphosphatase/sedoheptulose 1 7-bisphosphatase and
FT                   related protein; InterPro IPR004464; KEGG: chy:CHY_0787
FT                   fructose 1,6-bisphosphatase II; PFAM: GlpX family protein;
FT                   PRIAM: Fructose-bisphosphatase; SPTR:
FT                   Fructose-1,6-bisphosphatase, class II; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II; PFAM: Bacterial
FT                   fructose-1,6-bisphosphatase, glpX-encoded; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50585"
FT                   /db_xref="GOA:E6SGN9"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN9"
FT                   /protein_id="ADU50585.1"
FT                   /translation="MERELTLELVRVTEAAALAAARWMGRGDKNAADGAAVDAMRAVFD
FT                   TVDIRGTVVIGEGEMDEAPMLYIGEQVGSGQGPEVDVAVDPLEGTNLVAKGLPGAIAVL
FT                   AVAPRGCLLHAPDMYMEKIAVGPAAAGTIDIERPIEENLQAVARALNKRVQDVTVILLD
FT                   RPRHADLVARIRRAGARIRMISDGDVSAAIATALEGTGIDLMVGIGGAPEGVLAAAALY
FT                   CLGGELQGRLWPEDDEDRERMRAMGIDEARVLRIEDLVRGEDVIFAATGITSGEMLKGV
FT                   QFTSRGAFTHSVAMRYRTGTVRFVEAWHRLERKPVIGPLVGGTGPGAAG"
     MERELTLELV RVTEAAALAA ARWMGRGDKN AADGAAVDAM RAVFDTVDIR GTVVIGEGEM        60
     DEAPMLYIGE QVGSGQGPEV DVAVDPLEGT NLVAKGLPGA IAVLAVAPRG CLLHAPDMYM       120
     EKIAVGPAAA GTIDIERPIE ENLQAVARAL NKRVQDVTVI LLDRPRHADL VARIRRAGAR       180
     IRMISDGDVS AAIATALEGT GIDLMVGIGG APEGVLAAAA LYCLGGELQG RLWPEDDEDR       240
     ERMRAMGIDE ARVLRIEDLV RGEDVIFAAT GITSGEMLKG VQFTSRGAFT HSVAMRYRTG       300
     TVRFVEAWHR LERKPVIGPL VGGTGPGAAG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page