(data stored in ACNUC30630 zone)

EMBL: CP002344.PE462

CP002344.PE462       Location/Qualifiers
FT   CDS             548201..548719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0466"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="COGs: COG0693 Putative intracellular
FT                   protease/amidase; InterPro IPR006286: IPR002818; KEGG:
FT                   tte:TTE0986 putative intracellular protease/amidase; PFAM:
FT                   ThiJ/PfpI domain-containing protein; SPTR: Putative
FT                   intracellular protease/amidase; TIGRFAM: intracellular
FT                   protease, PfpI family; PFAM: DJ-1/PfpI family; TIGRFAM:
FT                   intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50587"
FT                   /db_xref="GOA:E6SGP1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP1"
FT                   /protein_id="ADU50587.1"
FT                   /translation="MAAKRIAILVDDLYEDLELWYPYYRLREAGHQVELIGSERERAYT
FT                   SKHHYPAKAVKSIAEVRSEDYDGVVIPGGYAPDKMRRDERMVRFVREIHDQGKLVAAIC
FT                   HAGWMLVSADILRGRKATSVRAIRDDMRNAGCQWVDEPVVVDGNLVTSRTPDDLPAYMK
FT                   AILAKLGEA"
     MAAKRIAILV DDLYEDLELW YPYYRLREAG HQVELIGSER ERAYTSKHHY PAKAVKSIAE        60
     VRSEDYDGVV IPGGYAPDKM RRDERMVRFV REIHDQGKLV AAICHAGWML VSADILRGRK       120
     ATSVRAIRDD MRNAGCQWVD EPVVVDGNLV TSRTPDDLPA YMKAILAKLG EA               172
//

If you have problems or comments...

PBIL Back to PBIL home page