(data stored in ACNUC30630 zone)

EMBL: CP002344.PE465

CP002344.PE465       Location/Qualifiers
FT   CDS             551039..552433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0469"
FT                   /product="transcriptional regulator of molybdate
FT                   metabolism, XRE family"
FT                   /note="COGs: COG1910 Periplasmic molybdate-binding
FT                   protein/domain; InterPro IPR001387; KEGG: ava:Ava_4042
FT                   molybdate metabolism transcriptional regulator; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional Regulator of
FT                   molybdate metabolism, XRE family protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50590"
FT                   /db_xref="GOA:E6SGP4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP4"
FT                   /protein_id="ADU50590.1"
FT                   /translation="MSSPGPMEPRGEPARRPRGAAGDPSGSVVNGLRAARLRLGLSQQE
FT                   LAARAGVTRQAVSAIEGGQAAPSLGVALRLARALGCRVEDLFWLDDPEPEVEVELVGTG
FT                   AEDPEPQGAPASRPAGPGGSAWSGGPGHAGLDASGGRCLVARIGGRWVAHRLRGDAAFS
FT                   SDLIPAGARLVGPASDEPAGPAQPGRAPGEPPAAPPPALTRWRARLLESPEDLARGVLI
FT                   AGCAPELSLWARALATGHRGVHLHRIEANSHRAVQLLRAGTVHAAGVHLPGPAGEPDNL
FT                   PFLQDLLGDLDVVVVRLGVWEEGLVVAPGNPLGIRDVADLARPGVVVVNREPGAGSRLL
FT                   LERCLAEAGVPAGAVAGFDRHARSHLEVARAVARGTAHAGVSTAPVAAAFGLGFVPLRA
FT                   VAYDLVFPRTVLDEPAVQALLGTLGDAWVRRQLAALGGFDTAATGTVTARLSRAHGPRV
FT                   PAIGSL"
     MSSPGPMEPR GEPARRPRGA AGDPSGSVVN GLRAARLRLG LSQQELAARA GVTRQAVSAI        60
     EGGQAAPSLG VALRLARALG CRVEDLFWLD DPEPEVEVEL VGTGAEDPEP QGAPASRPAG       120
     PGGSAWSGGP GHAGLDASGG RCLVARIGGR WVAHRLRGDA AFSSDLIPAG ARLVGPASDE       180
     PAGPAQPGRA PGEPPAAPPP ALTRWRARLL ESPEDLARGV LIAGCAPELS LWARALATGH       240
     RGVHLHRIEA NSHRAVQLLR AGTVHAAGVH LPGPAGEPDN LPFLQDLLGD LDVVVVRLGV       300
     WEEGLVVAPG NPLGIRDVAD LARPGVVVVN REPGAGSRLL LERCLAEAGV PAGAVAGFDR       360
     HARSHLEVAR AVARGTAHAG VSTAPVAAAF GLGFVPLRAV AYDLVFPRTV LDEPAVQALL       420
     GTLGDAWVRR QLAALGGFDT AATGTVTARL SRAHGPRVPA IGSL                        464
//

If you have problems or comments...

PBIL Back to PBIL home page