(data stored in ACNUC30630 zone)

EMBL: CP002344.PE474

CP002344.PE474       Location/Qualifiers
FT   CDS             561956..564091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0478"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR017896: IPR017900: IPR004017; KEGG: sth:STH623 putative
FT                   iron-sulfur cluster-binding protein; PFAM: protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; SPTR: Putative iron-sulfur cluster-binding
FT                   protein; PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50599"
FT                   /db_xref="GOA:E6SGW8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGW8"
FT                   /protein_id="ADU50599.1"
FT                   /translation="MPEAMPAVAEATREVQWNVPDAFVWIMYISMVVALAVMAYGVWQR
FT                   VRIWMAGKPEVRWDRPGQRLRRVLVHALGQGRLLKQRLPGIAHALLFYAFIVLFVGTLV
FT                   VMIHHDLGIPILRGRFYLYFHSLALDVFGALATVGLAVFFWRRYGLRPGQLEKGKRADF
FT                   LLLLGLLVIMVTGFVLEGIRLVVTGDPWAFWSPFGYLTGLALAAVLPAEGALRAVHAGT
FT                   WLLHMLTWHAWLAALPYSKAFHLVTGPLNIFFSNLDAKGEPKPMDLEDETASLGARTVL
FT                   DFTWKQLLDLDACTECGRCEAACPAFAEGKPLSPKRVILDLRDHVRAHRDDLLRAKAAQ
FT                   LAGDQETYESIVEHLPILAGGVIKEETLWACTTCRACEEACPVFIEHVPTILDMRRYLA
FT                   MEKAEMPETLASAMESLETRQHPYRGASADRTDWYKDLPVKTMAELDDPEEIEYLYWVG
FT                   CAGAFDERVQKVARAVARVMDRAGIKFAVLGPEEQCTGDPARRSGNEYHYAMLAQANVE
FT                   TLNGYKVKRIVTHCPHCLQQLKHEYKRFGGHYEVIHHSELVFKLMEEGKLELARELHRS
FT                   LQVTYHDPCYLGRYNDVYDAPRQVLDGLGTRRVEMARSRERSFCCGAGGAHMWYEDKSG
FT                   GKINRNRAEEAVRTGADVVVTGCPFCLAMMETGIKGVAGAEERGVRVRDFVELVEEALA
FT                   DPAGAVAGGEAGGAAGT"
     MPEAMPAVAE ATREVQWNVP DAFVWIMYIS MVVALAVMAY GVWQRVRIWM AGKPEVRWDR        60
     PGQRLRRVLV HALGQGRLLK QRLPGIAHAL LFYAFIVLFV GTLVVMIHHD LGIPILRGRF       120
     YLYFHSLALD VFGALATVGL AVFFWRRYGL RPGQLEKGKR ADFLLLLGLL VIMVTGFVLE       180
     GIRLVVTGDP WAFWSPFGYL TGLALAAVLP AEGALRAVHA GTWLLHMLTW HAWLAALPYS       240
     KAFHLVTGPL NIFFSNLDAK GEPKPMDLED ETASLGARTV LDFTWKQLLD LDACTECGRC       300
     EAACPAFAEG KPLSPKRVIL DLRDHVRAHR DDLLRAKAAQ LAGDQETYES IVEHLPILAG       360
     GVIKEETLWA CTTCRACEEA CPVFIEHVPT ILDMRRYLAM EKAEMPETLA SAMESLETRQ       420
     HPYRGASADR TDWYKDLPVK TMAELDDPEE IEYLYWVGCA GAFDERVQKV ARAVARVMDR       480
     AGIKFAVLGP EEQCTGDPAR RSGNEYHYAM LAQANVETLN GYKVKRIVTH CPHCLQQLKH       540
     EYKRFGGHYE VIHHSELVFK LMEEGKLELA RELHRSLQVT YHDPCYLGRY NDVYDAPRQV       600
     LDGLGTRRVE MARSRERSFC CGAGGAHMWY EDKSGGKINR NRAEEAVRTG ADVVVTGCPF       660
     CLAMMETGIK GVAGAEERGV RVRDFVELVE EALADPAGAV AGGEAGGAAG T                711
//

If you have problems or comments...

PBIL Back to PBIL home page