(data stored in ACNUC30630 zone)

EMBL: CP002344.PE476

CP002344.PE476       Location/Qualifiers
FT   CDS             566326..567111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0480"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: rmr:Rmar_1965 thioesterase superfamily
FT                   protein; PFAM: thioesterase superfamily protein; SPTR:
FT                   Thioesterase superfamily protein; PFAM: Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50601"
FT                   /db_xref="GOA:E6SGX0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX0"
FT                   /protein_id="ADU50601.1"
FT                   /translation="MLSWAARAIGEGPAGVRPLPRSGVRPMDDRQPQGMEGEGSGEGPV
FT                   AGAEPPGGRELPVPPARPARESRVEMTELVLPNDANPLGNILGGKVMHLMDIAGALAAA
FT                   RHSRRVCVTASVDRIDFLHPIRVGEAILVEAQVTDAGRTSMEVRVNVYSENLRTGQRRH
FT                   TATAFFTFVALDEHGRPTPVPAVIAETPDEQRLQIEARRRRQARLARAGRVGTAEPEAG
FT                   PPAGGDPSDPAASVGAPDPPSGGGTFDPPAGGDTPGPQA"
     MLSWAARAIG EGPAGVRPLP RSGVRPMDDR QPQGMEGEGS GEGPVAGAEP PGGRELPVPP        60
     ARPARESRVE MTELVLPNDA NPLGNILGGK VMHLMDIAGA LAAARHSRRV CVTASVDRID       120
     FLHPIRVGEA ILVEAQVTDA GRTSMEVRVN VYSENLRTGQ RRHTATAFFT FVALDEHGRP       180
     TPVPAVIAET PDEQRLQIEA RRRRQARLAR AGRVGTAEPE AGPPAGGDPS DPAASVGAPD       240
     PPSGGGTFDP PAGGDTPGPQ A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page