(data stored in ACNUC30630 zone)

EMBL: CP002344.PE482

CP002344.PE482       Location/Qualifiers
FT   CDS             574043..574855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0486"
FT                   /product="ABC transporter related protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro IPR003439:
FT                   IPR001827: IPR017871: IPR003593; KEGG: eba:p2A125 ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50607"
FT                   /db_xref="GOA:E6SGX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX6"
FT                   /protein_id="ADU50607.1"
FT                   /translation="MSVPWKIRIRGLRKEFVAGRRVIAALDGIDLEVAEGEFVCLVGPS
FT                   GCGKTTLLRILAGLEKPTAGTIEVAGSDPARPLQAMVFQEQSVFPWMTVRRNIGYGLAL
FT                   RRVPRAERERIVDHYLDLVGLTPFADAYPHQLSGGMKQRVSVARAFAVDPEILLMDEPF
FT                   AALDEQNKLLLAEELLRLWEANRKTVLYVTHSIDEAIHLADRIVVFTASPGRIKAEVPV
FT                   AIPRHRDLDTLRGHPAYAAAYQRVWQALRDEVLAARRHEERERVAGRR"
     MSVPWKIRIR GLRKEFVAGR RVIAALDGID LEVAEGEFVC LVGPSGCGKT TLLRILAGLE        60
     KPTAGTIEVA GSDPARPLQA MVFQEQSVFP WMTVRRNIGY GLALRRVPRA ERERIVDHYL       120
     DLVGLTPFAD AYPHQLSGGM KQRVSVARAF AVDPEILLMD EPFAALDEQN KLLLAEELLR       180
     LWEANRKTVL YVTHSIDEAI HLADRIVVFT ASPGRIKAEV PVAIPRHRDL DTLRGHPAYA       240
     AAYQRVWQAL RDEVLAARRH EERERVAGRR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page