(data stored in ACNUC30630 zone)

EMBL: CP002344.PE488

CP002344.PE488       Location/Qualifiers
FT   CDS             582073..583764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0492"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="COGs: COG1524 Uncharacterized protein of the AP
FT                   superfamily; InterPro IPR010916: IPR002591; KEGG:
FT                   gwc:GWCH70_2615 type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; SPTR: Type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; PFAM: Type I phosphodiesterase /
FT                   nucleotide pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50613"
FT                   /db_xref="GOA:E6SGY2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY2"
FT                   /protein_id="ADU50613.1"
FT                   /translation="MKAASAVEVTAARVWNLLNEGKSFYPLFNLGLLAVLVVSDPAWRR
FT                   GALAGGGVGLAVALAASLPLVLAYVRWDFPLHLRWFLWPPFLAFGLLFGWPSPAALGLS
FT                   AGLYLFFTVIVWGTIYYHLRTGTTLWNFLRFWKLVLKNADSTSGNAQEQLPKSFLTLAV
FT                   WQHLLVAAAPQGAGAAAAGPGALAATGPGVAAAGSIAAGGTVLPTAATAGPGLPGDVGS
FT                   AALPVFLFTLGTALYAAAVHRIGFNWRPAEYPDYAAAPAPLPRPSRRVVVIVIDGCRKD
FT                   KLERAETPFLDWLAARGTRFDRMETVYPARTVVCFSSMFTGTYPREHGITSNLVLRLGV
FT                   RVESVFDVLRRHGRQGVLLGIAHLIDAFGDDVRAITSVQHGDVVDGNIMAAARQILEQD
FT                   DPDLLIVQLIATDQTGHARGVHDPQYLQRIREADAHIEAFFAWMHRHGYTRDTTFLICA
FT                   DHGQGDGIGGHGHLGEGERWVPFFLVGRNVARGRRVDRPHSIVSVAGTLMHLLGLPLPG
FT                   RARGPVLEEALEPGAPDLAADLEGYFAGPTPARAASPVLAERGVSR"
     MKAASAVEVT AARVWNLLNE GKSFYPLFNL GLLAVLVVSD PAWRRGALAG GGVGLAVALA        60
     ASLPLVLAYV RWDFPLHLRW FLWPPFLAFG LLFGWPSPAA LGLSAGLYLF FTVIVWGTIY       120
     YHLRTGTTLW NFLRFWKLVL KNADSTSGNA QEQLPKSFLT LAVWQHLLVA AAPQGAGAAA       180
     AGPGALAATG PGVAAAGSIA AGGTVLPTAA TAGPGLPGDV GSAALPVFLF TLGTALYAAA       240
     VHRIGFNWRP AEYPDYAAAP APLPRPSRRV VVIVIDGCRK DKLERAETPF LDWLAARGTR       300
     FDRMETVYPA RTVVCFSSMF TGTYPREHGI TSNLVLRLGV RVESVFDVLR RHGRQGVLLG       360
     IAHLIDAFGD DVRAITSVQH GDVVDGNIMA AARQILEQDD PDLLIVQLIA TDQTGHARGV       420
     HDPQYLQRIR EADAHIEAFF AWMHRHGYTR DTTFLICADH GQGDGIGGHG HLGEGERWVP       480
     FFLVGRNVAR GRRVDRPHSI VSVAGTLMHL LGLPLPGRAR GPVLEEALEP GAPDLAADLE       540
     GYFAGPTPAR AASPVLAERG VSR                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page