(data stored in ACNUC30630 zone)

EMBL: CP002344.PE49

CP002344.PE49        Location/Qualifiers
FT   CDS             42270..43706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0049"
FT                   /product="phage tail component"
FT                   /note="COGs: COG4722 Phage-related protein; InterPro
FT                   IPR008841: IPR006520; KEGG: bcg:BCG9842_B1390 phage tail
FT                   fiber protein; PFAM: tail component family protein; SPTR:
FT                   Phage-related protein; TIGRFAM: phage tail component; PFAM:
FT                   Phage tail protein; TIGRFAM: putative phage tail component,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50174"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI7"
FT                   /protein_id="ADU50174.1"
FT                   /translation="MAWGFRYDGIHSANKGVHSVTDVRRSILPPVTARTLDTPGRPGVY
FT                   YQGFDYGAREIQVDIILAESTLESLRSRVRNLAAWLRPDDTPRPLVFDDEPELTWYAVL
FT                   SGDTNLEEIVTVGRGTLTFLCPEPYAIGPERVLTIADGATVTAQGTADTYPIIRATVQR
FT                   DITFLSIGTVDRYVLLGTPSEVEQASVPPYERIMSDELTTTEGWVDGLDADGGLVAGTM
FT                   TSNGNEFVVADYGIGSGWHGPALQKGLPELVQDFRVTMWVQAINGKAEVGRVEAYLLDQ
FT                   TGAIIGKIGLADKYAGRDEMWGIARAGNLANGTYIINEYGDRRGVWNDFYGVLRIGRVG
FT                   NTWEAYIAKYDPVKRVYHTRRLRRWTDTKGRWTAPLARVQLHAGAYGENPPMSVRILSV
FT                   TVERVNKLQLSDVPIIAGPGDEIEIDCERFAVRLNGEHALELLDPSSQFFVLRPGEPVT
FT                   FDVSPPGAATVELRYRERWL"
     MAWGFRYDGI HSANKGVHSV TDVRRSILPP VTARTLDTPG RPGVYYQGFD YGAREIQVDI        60
     ILAESTLESL RSRVRNLAAW LRPDDTPRPL VFDDEPELTW YAVLSGDTNL EEIVTVGRGT       120
     LTFLCPEPYA IGPERVLTIA DGATVTAQGT ADTYPIIRAT VQRDITFLSI GTVDRYVLLG       180
     TPSEVEQASV PPYERIMSDE LTTTEGWVDG LDADGGLVAG TMTSNGNEFV VADYGIGSGW       240
     HGPALQKGLP ELVQDFRVTM WVQAINGKAE VGRVEAYLLD QTGAIIGKIG LADKYAGRDE       300
     MWGIARAGNL ANGTYIINEY GDRRGVWNDF YGVLRIGRVG NTWEAYIAKY DPVKRVYHTR       360
     RLRRWTDTKG RWTAPLARVQ LHAGAYGENP PMSVRILSVT VERVNKLQLS DVPIIAGPGD       420
     EIEIDCERFA VRLNGEHALE LLDPSSQFFV LRPGEPVTFD VSPPGAATVE LRYRERWL         478
//

If you have problems or comments...

PBIL Back to PBIL home page