(data stored in ACNUC30630 zone)

EMBL: CP002344.PE491

CP002344.PE491       Location/Qualifiers
FT   CDS             585786..586928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0495"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1840 ABC-type Fe3+ transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   rxy:Rxyl_1175 extracellular solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Extracellular solute-binding protein, family 1; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50616"
FT                   /db_xref="GOA:E6SGY5"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY5"
FT                   /protein_id="ADU50616.1"
FT                   /translation="MVEPAPRADRSGGPEGSRRPRQRALRPWLRARGGWQRALRRPRGA
FT                   LRLVAVLALAGFVLSGCGVLGRSGRQELVVYSSRTQSLVHPLLEQFARETGIDIKVRYA
FT                   STAELVNTLLEEGERSAADVLYLADAGGWGPLRQAGLLAELPQDVLEKVDPRFRSPDGQ
FT                   WVGVSGRSKVIVYNKNKIDPGRDLPDSVMDLTDPKWKGRIGWAPTHGEWQILVTAIRLT
FT                   KGEDAARQWLEGMKANDPKEYPNLISIVRAVADGEVDIGVVNHYYVPRLMEELGPDFAA
FT                   RNYFLKNGDPGAVIDVTGAAILKSTKNREAAERFVRFLLSEEAQRYFTQETKEYPMIAG
FT                   IPLPAGLPPMEELDPPAIDQSDLGQLQQTVELLRETGVLP"
     MVEPAPRADR SGGPEGSRRP RQRALRPWLR ARGGWQRALR RPRGALRLVA VLALAGFVLS        60
     GCGVLGRSGR QELVVYSSRT QSLVHPLLEQ FARETGIDIK VRYASTAELV NTLLEEGERS       120
     AADVLYLADA GGWGPLRQAG LLAELPQDVL EKVDPRFRSP DGQWVGVSGR SKVIVYNKNK       180
     IDPGRDLPDS VMDLTDPKWK GRIGWAPTHG EWQILVTAIR LTKGEDAARQ WLEGMKANDP       240
     KEYPNLISIV RAVADGEVDI GVVNHYYVPR LMEELGPDFA ARNYFLKNGD PGAVIDVTGA       300
     AILKSTKNRE AAERFVRFLL SEEAQRYFTQ ETKEYPMIAG IPLPAGLPPM EELDPPAIDQ       360
     SDLGQLQQTV ELLRETGVLP                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page