(data stored in ACNUC30630 zone)

EMBL: CP002344.PE495

CP002344.PE495       Location/Qualifiers
FT   CDS             591676..592788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0499"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG1087 UDP-glucose 4-epimerase; InterPro
FT                   IPR008089: IPR020904: IPR001509; KEGG: rca:Rcas_4269
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: Putative uncharacterized
FT                   protein; PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50620"
FT                   /db_xref="GOA:E6SGY9"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY9"
FT                   /protein_id="ADU50620.1"
FT                   /translation="MRLLITGGAGFIGSHLAELALLQGADVVVLDNFTANYDTALKQAN
FT                   VELLRRRAARATGGFRFVRGDVRNGELLDRLFARHRFTHVAHLAALPGVRPSLAEPRRY
FT                   LEANVGGTVALFEAVRRHGRGVERVLVASSSSVYGAQPGPWREDMPLAPLSPYAASKAA
FT                   AEQYALTYHRLLGVGVTCLRFFTVYGPRQRPDMAIAKFTACALAGRPIPVLGDIRSRRD
FT                   YTEVGDVVRGAWAALLEPGADFQVYNLGSGRPVTLQDLIAALGRVLHRPIALDLQPPAP
FT                   GDAPATWADISRARERLGYEPRVSLEQGLARYVAWVRARGPGYRGTTGTSCSGPRGNRP
FT                   ARHLTGHPSPAETVLCATALRITLRDEDHN"
     MRLLITGGAG FIGSHLAELA LLQGADVVVL DNFTANYDTA LKQANVELLR RRAARATGGF        60
     RFVRGDVRNG ELLDRLFARH RFTHVAHLAA LPGVRPSLAE PRRYLEANVG GTVALFEAVR       120
     RHGRGVERVL VASSSSVYGA QPGPWREDMP LAPLSPYAAS KAAAEQYALT YHRLLGVGVT       180
     CLRFFTVYGP RQRPDMAIAK FTACALAGRP IPVLGDIRSR RDYTEVGDVV RGAWAALLEP       240
     GADFQVYNLG SGRPVTLQDL IAALGRVLHR PIALDLQPPA PGDAPATWAD ISRARERLGY       300
     EPRVSLEQGL ARYVAWVRAR GPGYRGTTGT SCSGPRGNRP ARHLTGHPSP AETVLCATAL       360
     RITLRDEDHN                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page