(data stored in ACNUC30630 zone)

EMBL: CP002344.PE496

CP002344.PE496       Location/Qualifiers
FT   CDS             592840..594069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0500"
FT                   /product="SMC domain protein"
FT                   /note="COGs: COG4637 ATPase; InterPro IPR014555: IPR003395;
FT                   KEGG: bpe:BP3115 hypothetical protein; PFAM: SMC domain
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50621"
FT                   /db_xref="GOA:E6SGZ0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ0"
FT                   /protein_id="ADU50621.1"
FT                   /translation="MAASPVRPFVEFIKIRNYKSIGRCEVRLNRLTVLVGPNGSGKSNF
FT                   LDALRFVADALRTTLEHAIRDRGGINEVRRRSYGHPHNLGITLGINVPDGSRAIYEFQV
FT                   GSSQDSGYQVVRESCKLAPASSPSSWIHSYVVERGRLREASFIGKGPDQIAIDRLYLTV
FT                   VSALPEFRALYDGLSNMGFYNLNPDVIRDIQDPDPGELLDRDGRNMASVIRRLRETNPA
FT                   VLERIIEYLQAVVPGVRSVDALHLQRKETLEFRQEVRGAKHPWKFSATNMSDGTLRALG
FT                   VLVAAFQTQALRKFQVPLVGIEEPEIAIHPGAAVKLMDALLEAKRYTQILITTHSPELL
FT                   DHPQLTDDMILAVEAEHGETYIAPVDQQIRQVIRNNLYTVGHLLRLGQLQPDRVGFEPL
FT                   PRQLEFAFQQ"
     MAASPVRPFV EFIKIRNYKS IGRCEVRLNR LTVLVGPNGS GKSNFLDALR FVADALRTTL        60
     EHAIRDRGGI NEVRRRSYGH PHNLGITLGI NVPDGSRAIY EFQVGSSQDS GYQVVRESCK       120
     LAPASSPSSW IHSYVVERGR LREASFIGKG PDQIAIDRLY LTVVSALPEF RALYDGLSNM       180
     GFYNLNPDVI RDIQDPDPGE LLDRDGRNMA SVIRRLRETN PAVLERIIEY LQAVVPGVRS       240
     VDALHLQRKE TLEFRQEVRG AKHPWKFSAT NMSDGTLRAL GVLVAAFQTQ ALRKFQVPLV       300
     GIEEPEIAIH PGAAVKLMDA LLEAKRYTQI LITTHSPELL DHPQLTDDMI LAVEAEHGET       360
     YIAPVDQQIR QVIRNNLYTV GHLLRLGQLQ PDRVGFEPLP RQLEFAFQQ                   409
//

If you have problems or comments...

PBIL Back to PBIL home page