(data stored in ACNUC30630 zone)

EMBL: CP002344.PE511

CP002344.PE511       Location/Qualifiers
FT   CDS             611280..612014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2616 chromate transporter; SPTR:
FT                   Chromate transporter, chromate ion transporter (CHR)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50636"
FT                   /db_xref="GOA:E6SH05"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH05"
FT                   /protein_id="ADU50636.1"
FT                   /translation="MSGGLLRLHLRLARPGLVATACLGLAFVPVLVWPERLTGHPLGLH
FT                   TLLRLVEEFLVLVVLPVTVPLWSDVEGRRPVLWRALPFRRAVVVLWRFGLPLAAFALVA
FT                   TGMVGLAALRTAAPGGVSWQVGLRVVALALPAAAWLGALAALVSVLVRVPVAGAGAAMA
FT                   WWALEAVTQGDVTGSLYLFAASGGLRGAGVDPGAILEALALGNPLPPAFLANRWELVGL
FT                   ACLAALATAELYRRNERFLRQD"
     MSGGLLRLHL RLARPGLVAT ACLGLAFVPV LVWPERLTGH PLGLHTLLRL VEEFLVLVVL        60
     PVTVPLWSDV EGRRPVLWRA LPFRRAVVVL WRFGLPLAAF ALVATGMVGL AALRTAAPGG       120
     VSWQVGLRVV ALALPAAAWL GALAALVSVL VRVPVAGAGA AMAWWALEAV TQGDVTGSLY       180
     LFAASGGLRG AGVDPGAILE ALALGNPLPP AFLANRWELV GLACLAALAT AELYRRNERF       240
     LRQD                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page