(data stored in ACNUC30630 zone)

EMBL: CP002344.PE59

CP002344.PE59        Location/Qualifiers
FT   CDS             complement(55237..55650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_2499 peptidase S1 and S6,
FT                   chymotrypsin/Hap; SPTR: Peptidase S1 and S6
FT                   chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50184"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ7"
FT                   /protein_id="ADU50184.1"
FT                   /translation="MGVNLSAIQSIEDLLAACEGDPVSLEHARNWAAGRLHTYLGVKED
FT                   SLRPGYLYLHDSYEAQALVATDIIFVRASYDPEETKAWVREARKYTDRVIKVPPPFRFR
FT                   PWFPLEESFEEWRTAMRSAAEEYRKLVETLMAE"
     MGVNLSAIQS IEDLLAACEG DPVSLEHARN WAAGRLHTYL GVKEDSLRPG YLYLHDSYEA        60
     QALVATDIIF VRASYDPEET KAWVREARKY TDRVIKVPPP FRFRPWFPLE ESFEEWRTAM       120
     RSAAEEYRKL VETLMAE                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page