(data stored in ACNUC30630 zone)

EMBL: CP002344.PE61

CP002344.PE61        Location/Qualifiers
FT   CDS             complement(56314..56730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppl:POSPLDRAFT_93294 hypothetical protein;
FT                   SPTR: Plasmid partitioning protein, ParA1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50186"
FT                   /db_xref="GOA:E6SKJ9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ9"
FT                   /protein_id="ADU50186.1"
FT                   /translation="MAKEAVLLKIDPALAQRLRVRAAEERTTMSAIVERALRKELGEMT
FT                   NRDEFARTLGYADWDALMAASEEVAVEGDISWYVSRLPDGRWAAWDDAEIALDRVSIHA
FT                   TREEAVAYQYDGWTASHEEEAETERVRWLAERPD"
     MAKEAVLLKI DPALAQRLRV RAAEERTTMS AIVERALRKE LGEMTNRDEF ARTLGYADWD        60
     ALMAASEEVA VEGDISWYVS RLPDGRWAAW DDAEIALDRV SIHATREEAV AYQYDGWTAS       120
     HEEEAETERV RWLAERPD                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page