(data stored in ACNUC30630 zone)

EMBL: CP002344.PE63

CP002344.PE63        Location/Qualifiers
FT   CDS             57828..58136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_3779 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50188"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK1"
FT                   /protein_id="ADU50188.1"
FT                   /translation="MVKATILVPVKDNDGRPFEWEAWQELQQRLLQFGGYTDGGLVAGA
FT                   WESEGRVYQDENRQFIIALSSWRDVPRFLDLAEWVRVRFRQEAVYIEIAGIPEILAG"
     MVKATILVPV KDNDGRPFEW EAWQELQQRL LQFGGYTDGG LVAGAWESEG RVYQDENRQF        60
     IIALSSWRDV PRFLDLAEWV RVRFRQEAVY IEIAGIPEIL AG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page