(data stored in ACNUC30630 zone)

EMBL: CP002344.PE65

CP002344.PE65        Location/Qualifiers
FT   CDS             complement(58834..59085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH1887 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50190"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK3"
FT                   /protein_id="ADU50190.1"
FT                   /translation="MGLVDQPVQAWADAQGRPAAFLWRGVRRRVVEILDEWRELGRWWE
FT                   GDPPEERYVYRVRTEDGGVYEIEYRRPAGRWFLYKVWD"
     MGLVDQPVQA WADAQGRPAA FLWRGVRRRV VEILDEWREL GRWWEGDPPE ERYVYRVRTE        60
     DGGVYEIEYR RPAGRWFLYK VWD                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page